KEGG   Streptococcus pneumoniae TCH8431/19A: HMPREF0837_11019Help
Entry
HMPREF0837_11019  CDS       T01259                                 

Definition
phospho-beta-gluco or galactosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
snc  Streptococcus pneumoniae TCH8431/19A
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:snc00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
939354..939650
Genome map
AA seq 98 aa AA seqDB search
MDTPDENGYVADDYRITYLEAHIKAMRDAIYQDGVDLLGYTTWGCIDPVSAGTGEMNKRY
GFIYVDRDNVGNGVLKRSKKKSFYWYKDVIDSNGASIE
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atggatacaccggatgagaatggttatgtagcagatgactatcggattacttacttagag
gcccacatcaaggccatgcgagatgccatttaccaagacggggttgacttgcttggttat
acgacttggggctgtatcgatccggtttcagctggcacaggggaaatgaataagcgctat
ggctttatctatgtagatcgagataatgtaggaaacggagttctcaaacgtagcaagaag
aagtccttctattggtacaaggatgtcattgatagcaatggtgcaagcatcgagtag

DBGET integrated database retrieval system