KEGG   Streptococcus pneumoniae TCH8431/19A: HMPREF0837_11224Help
Entry
HMPREF0837_11224  CDS       T01259                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
snc  Streptococcus pneumoniae TCH8431/19A
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:snc00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:snc00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1119487..1120410
Genome map
AA seq 307 aa AA seqDB search
MSENQQALNHVVSMEDLTVDQVMKLIKRGIEFKNGAQLPYEDHPIVSNLFFEDSTRTHKS
FEVAEIKLGLERLDFDVKTSSVNKGETLYDTILTLSALGVDVCVIRHPEVDYYRELIASP
TITTSIINGGDGSGQHPSQSLLDLMTIYEEFGHFEGLKVAIAGDLDHSRVAKSNMQILKR
LGSELFFAGPEEWRSQEFADYGQFVTIDEIIDQVDVMMFLRVQHERHDSGAVFSKEDYHA
QHGLTQERYDRLKETAILMHPAPINRDVEIADHLVEAPKSRIVQQMTNGVFVRMAILESV
LASRNAN
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaaatcaacaagcattgaaccatgtggtgtccatggaagacctcactgtcgat
caagtaatgaaattgatcaagcgaggaattgagtttaaaaatggagcccagcttccctat
gaagaccatccgattgtttccaatctcttctttgaggattctacacggacacataagtcc
tttgaagtcgcagagattaaacttggattggaacgacttgactttgatgtgaagactagt
tcggttaataagggtgagacactttatgacaccattttgactctgtctgctttaggagtg
gatgtctgtgtgattcgccatccagaggtcgactactatagagaattgattgctagtcca
acgattacgacttccatcatcaatggtggagatggttcgggccaacaccctagccagagc
ttgcttgatttgatgaccatttatgaggaatttggccactttgagggtcttaaagttgct
attgcaggtgacttggaccactcacgcgttgccaaatccaatatgcagattttgaaacgc
ttgggatctgaactctttttcgctggacctgaggaatggagaagtcaagagtttgcagac
tatggacagtttgtaaccattgatgaaatcattgatcaggttgatgtcatgatgtttctc
cgtgtgcaacacgaacgccatgatagtggagctgtattttcaaaagaagactaccatgcc
caacatggcttgactcaagaacgttacgatcgtttgaaagaaacagcaatcctcatgcac
ccagctccaatcaatcgtgatgtagaaatagcagaccacttggttgaagcaccaaaatca
cggattgtccaacaaatgaccaatggtgtctttgttcgaatggcaatcttagaatccgta
ctagcgagtagaaacgccaactaa

DBGET integrated database retrieval system