KEGG   Streptococcus pneumoniae TCH8431/19A: HMPREF0837_11518Help
Entry
HMPREF0837_11518  CDS       T01259                                 

Gene name
mutM
Definition
DNA-(apurinic or apyrimidinic site) lyase (EC:4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
snc  Streptococcus pneumoniae TCH8431/19A
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:snc03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1399541..1400365)
Genome map
AA seq 274 aa AA seqDB search
MPELPEVETVCRGLEKLIIGKKISSIEIRYPKMIKTDLEEFQRELPSQIIESMGRRGKYL
LFYLTDKVLISHLRMEGKYFYYPDQGPERKHAHVFFHFEDGGTLVYEDVRKFGTMELLVP
DLLDAYFISKKLGPEPSEQDFDLQVFQSALAKSKKPIKSHLLDQTLVAGLGNIYVDEVLW
RAQVHPARPSQTLTAEEATAIHDQTIAVLGQAVEKGGSTIRTYTNAFGEDGSMQDFHQVY
DKTGQECVRCGTIIEKIQLGGRGTHFCPNCQRRD
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaattacctgaggttgaaaccgtttgtcgtggcttagaaaaattgattatagga
aagaagatttcgagtatagaaattcgctaccccaagatgattaagacggatttggaagag
tttcaaagggaattgcctagtcagattatcgagtcaatgggacgtcgtggaaaatatttg
cttttttatctgacagacaaggtcttgatttcccatttgcggatggagggcaagtatttt
tactatccagaccaaggacctgaacgcaagcatgcccatgttttctttcattttgaagat
ggtggcacgcttgtttatgaggatgttcgcaagtttggaaccatggaactcttggtgcct
gaccttttagacgcctactttatttctaaaaaattaggtcctgaaccaagcgaacaagac
tttgatttacaggtctttcaatctgcccttgccaagtccaaaaagcctatcaaatcccat
ctcctagaccagaccttggtagctggacttggcaatatctatgtggatgaggttctctgg
cgagctcaggttcatccagctagaccttcccagactttgacagcagaagaagcgactgcc
attcatgaccagaccattgctgttttgggccaggctgttgaaaaaggtggctccaccatt
cggacttataccaatgcctttggggaagatggaagcatgcaggactttcatcaggtctat
gataagactggtcaagaatgtgtacgctgtggtaccatcattgagaaaattcaactaggc
ggacgaggcacccacttttgtccaaactgtcaaaggagggactga

DBGET integrated database retrieval system