KEGG   Streptococcus pneumoniae TCH8431/19A: HMPREF0837_11594Help
Entry
HMPREF0837_11594  CDS       T01259                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
snc  Streptococcus pneumoniae TCH8431/19A
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:snc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HMPREF0837_11594 (pfkA)
   01230 Biosynthesis of amino acids
    HMPREF0837_11594 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0837_11594 (pfkA)
   00030 Pentose phosphate pathway
    HMPREF0837_11594 (pfkA)
   00051 Fructose and mannose metabolism
    HMPREF0837_11594 (pfkA)
   00052 Galactose metabolism
    HMPREF0837_11594 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    HMPREF0837_11594 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    HMPREF0837_11594 (pfkA)
Enzymes [BR:snc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     HMPREF0837_11594 (pfkA)
Protein phosphatases and associated proteins [BR:snc01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     HMPREF0837_11594 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1462545..1463552)
Genome map
AA seq 335 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVFGIYDGYAGMVAGEIHPLDAALVGDI
ISRGGTFLHSARYPEFAQLEGQLKGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAI
GLPGTIDNDIVGTDFTIGFDTAVTTAMDAIDKIRDTSSSHRRTFVIEVMGRNAGDIALWA
GIATGADEIIIPEAGFKMEDIVASIKAGYECGKKHNIIVLAEGVMSAAEFGQKLKEAGDT
SDLRVTELGHIQRGGSPTARDRVLASRMGAHAVKLLKEGIGGVAVGIRNEKMVENPILGT
AEEGALFSLTAEGKIVVNNPHKADIELSSLNKSLS
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtattgctgttttgactagtggcggagacgcacctggtatgaacgctgccatc
cgtgcagttgttcgtcaagcaatttcagaaggaatggaagtgtttggtatctatgacgga
tatgctggtatggttgccggtgaaattcatcccctagatgcagctttagtaggggacatc
atttctcgtggtggtacttttcttcactcagctcgttatccagagttcgctcaacttgaa
gggcaacttaaagggattgagcaattgaaaaaacacggaattgaaggtgtagttgttatc
ggtggtgacggatcttaccacggcgctatgcgtttgactgaacatggcttcccagctatt
ggtcttccaggtacaatcgataacgatatcgttggtactgactttacaatcggttttgac
acagcggttactactgccatggacgctatcgataagattcgtgatacatcatcaagtcac
cgtcgtacttttgtaatcgaagttatgggacgtaacgctggtgatatcgctctttgggct
ggtattgcaactggtgctgatgaaatcatcatccctgaagcaggcttcaagatggaagat
atcgtagcaagcatcaaagctggttatgaatgtggtaaaaaacacaatatcatcgtctta
gctgaaggtgtgatgtcagcggctgaatttggtcaaaaacttaaagaagctggagataca
agcgaccttcgtgtaacagaacttggacatattcaacgtggtggttctccaactgcgcgt
gaccgtgttttggcgtcacgtatgggtgcacatgctgttaaacttcttaaagaaggtatc
ggtggtgttgcggttggtattcgtaacgaaaaaatggttgaaaatccaattcttggtact
gcagaagaaggggcattgtttagccttactgcagaaggtaagattgtggttaacaacccg
cacaaagccgatattgagctatctagcttgaataagagcttgtcataa

DBGET integrated database retrieval system