KEGG   Streptococcus pneumoniae TCH8431/19A: HMPREF0837_11617Help
Entry
HMPREF0837_11617  CDS       T01259                                 

Gene name
fruK
Definition
1-phosphofructokinase (EC:2.7.1.56)
Orthology
K00882  
1-phosphofructokinase [EC:2.7.1.56]
Organism
snc  Streptococcus pneumoniae TCH8431/19A
Pathway
Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:snc00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    HMPREF0837_11617 (fruK)
Enzymes [BR:snc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.56  1-phosphofructokinase
     HMPREF0837_11617 (fruK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1489509..1490420)
Genome map
AA seq 303 aa AA seqDB search
MIYTVTLNPSIDYIVRLDQVKVGSVNRMDSDDKFAGGKGINVSRVLKRLNIPNTATGFIG
GFTGKFITDTLAEEEIETRFVQVAEDTRINVKIKADQETEINGTGPTVESVQLEELKAIL
SSLTAEDTVVFAGSSAKNLGNVIYKDLISLTRQTGAQVVCDFEGQTLIDSLDYQPLLVKP
NNHELGAIFGVKLESLDEIEKYARELLAKGAQNVIISMAGDGALLVTSEGAYFAKPIKGT
VKNSVGAGDSMVAGFTGEFVKSKDAVEAFKWGVACGTATTFSDDLATAEFIKETYGKVEV
EKR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgatttatacagtcacactcaatccatccattgactatatcgttcgtttggaccaagtc
aaagttggtagtgtcaatcgtatggacagtgatgataagtttgctggtgggaaaggaatc
aatgtcagccgtgtcttgaaacgtttgaatataccaaatacagcgacgggatttatcggt
ggctttactggtaaatttatcacagatactttagcagaggaagaaatcgagacacgtttt
gtccaggtggcagaagatactcgtatcaatgttaaaatcaaagcagaccaagaaacagaa
atcaacggaacgggtccaactgttgaatcggttcagctagaagaattgaaagctatttta
tctagtctgacagcagaagatacagttgtctttgcaggttcaagtgctaaaaatctaggc
aatgttatctataaggatttgatttccttgacgcgccagactggtgcgcaagtggtctgt
gactttgaaggacagaccttaattgatagtttggactaccagcctcttcttgtaaaacca
aacaatcatgaacttggagcgatttttggggttaaactcgaaagtttagatgaaattgag
aaatacgctcgtgagttactggctaagggtgctcaaaatgttattatctctatggctggt
gatggtgcccttcttgtcacatctgagggagcttacttcgctaaaccaatcaaaggaaca
gtcaaaaattcagttggagctggtgattctatggttgctggattcacaggtgaatttgtc
aaatcaaaagacgcagtagaagccttcaaatggggagtggcttgcggaacggcaactacc
ttctcagatgacttggcaacggcggaatttattaaagaaacatatggaaaagttgaggta
gaaaaacgatga

  All links  
No link information was found.   
DBGET integrated database retrieval system