KEGG   Streptococcus pneumoniae TCH8431/19A: HMPREF0837_12038Help
Entry
HMPREF0837_12038  CDS       T01259                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
snc  Streptococcus pneumoniae TCH8431/19A
Pathway
snc00260  Glycine, serine and threonine metabolism
snc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
snc01100  Metabolic pathways
snc01110  Biosynthesis of secondary metabolites
snc01130  Biosynthesis of antibiotics
snc01230  Biosynthesis of amino acids
Module
snc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:snc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0837_12038 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HMPREF0837_12038 (trpA)
Enzymes [BR:snc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HMPREF0837_12038 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA
Motif
Other DBs
NCBI-ProteinID: ADI70266
UniProt: D6ZN26
Structure
PDB: 

Jmol
Position
complement(1867836..1868612)
Genome map
AA seq 258 aa AA seqDB search
MPKTLTKKLNAIKAAGKGIFVPYIMAGDHEKGLDGLAETIHFLEDLGVSAIEVGIPFSDP
VADGPVIEEAGLRSLAHGTSTQALVETLKTIETEIPLVIMTYFNPLFQYGVENFVKDLAD
TAVKGLIIPDLPHEHANFVEPFLADTDIALIPLVSLTTGIERQKELIEGAEGFVYAVAIN
GVTGKSGNYRADLDKHLAQLHQVADIPVLTGFGVSSQADLERFNAVSDGVIVGSKIVKAL
HQGEPIQDFIKQAVAYQK
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcctaagacactaacaaaaaaattaaatgctattaaagcagctggaaaaggaattttt
gttccctatatcatggctggtgaccacgaaaaaggtttggatggtcttgctgaaacaatt
cactttttagaagatttgggtgtctctgcaattgaagtgggtattcccttttcagaccct
gttgcagatggacctgttatcgaagaagctggcttgcgcagtttagcccacgggacctct
acccaggctttagttgaaaccttgaaaaccattgaaacagagattccactggtcatcatg
acctacttcaaccccctctttcagtacggtgtggagaactttgtcaaagatctggctgat
acagctgtgaagggcttgattatcccagacctgcctcatgaacatgccaactttgtagaa
ccatttttggcagatacagatatcgccttgattcctttagtaagcttgaccacaggaatt
gagcgccagaaagagttgattgaaggggcggagggattcgtctatgccgttgccatcaat
ggggtaacagggaaatcaggcaattaccgtgcagatttggacaagcacttggcgcaactt
catcaagtggccgacatcccagtcttgacaggttttggtgtatctagtcaagccgatctg
gaacgcttcaatgcggtgtcagatggtgttatcgtcggttcgaaaatagtaaaagctctc
caccaaggagagccgattcaggactttatcaaacaagcagtagcttaccaaaaataa

DBGET integrated database retrieval system