KEGG   Streptococcus pneumoniae TCH8431/19A: HMPREF0837_12039Help
Entry
HMPREF0837_12039  CDS       T01259                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
snc  Streptococcus pneumoniae TCH8431/19A
Pathway
snc00260  Glycine, serine and threonine metabolism
snc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
snc01100  Metabolic pathways
snc01110  Biosynthesis of secondary metabolites
snc01130  Biosynthesis of antibiotics
snc01230  Biosynthesis of amino acids
Module
snc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:snc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HMPREF0837_12039 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HMPREF0837_12039 (trpB)
Enzymes [BR:snc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HMPREF0837_12039 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADI70267
UniProt: D6ZN27
Structure
PDB: 

Jmol
Position
complement(1868605..1869828)
Genome map
AA seq 407 aa AA seqDB search
MAYQEPNKDGFYGKFGGRFVPETLMTAVLELEKAYRESQADPSFQEELNQLLRQYVGRET
PLYYAKNLTQHIGGAKIYLKREDLNHTGAHKINNALGQVWLAKRMGKKKIIAETGAGQHG
VATATAAALFNMECTIYMGEEDVKRQALNVFRMELLGAKVEAVTDGSRVLKDAVNAALRS
WVANIDDTHYILGSALGPHPFPEIVRDFQSVIGREAKQQYRDLTGQNLPDALVACVGGGS
NAIGLFHPFVEDESVAMYGAEAAGFGVDTEHHAATLTKGRPGVLHGSLMDVLQDAHGQIL
EAFSISAGLDYPGIGPEHSHYHDIKRASYVPVTDEEALEGFQLLSRVEGIIPALESSHAI
AFAVKLAKELGPEKSMIVCLSGRGDKDVVQVKDRLEADAAKKGEAHA
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggcatatcaggaaccaaataaagatggattttacggaaaattcggcggacgttttgtc
ccagaaacattgatgacagcagttttggagttggagaaggcctaccgtgaaagtcaggca
gacccaagtttccaagaggaattaaaccagcttttgcgccagtacgtaggacgtgaaact
cctctttattacgcaaaaaacttgacccagcatatcggcggagccaagatttatctcaaa
cgggaagaccttaaccatacaggagcccacaagattaacaatgccttgggacaagtttgg
cttgccaaacgcatgggtaaaaagaaaattatcgcagaaactggtgctggtcagcacggt
gtggcaactgcaactgctgcggccctctttaacatggaatgtaccatctacatgggtgag
gaagatgtcaaacgccaagccctcaatgtcttccgtatggagcttttgggagctaaggtc
gaggccgtgacagatggttcgcgcgtgctcaaggatgcggtcaatgcagcccttcgttca
tgggtggctaatatagatgatacccactatatccttggttctgccttggggcctcatcca
tttccagaaattgttcgtgacttccaaagtgtcattggtcgagaggctaaacaacagtac
cgtgacttgacaggacaaaatctgccagatgccctagtagcctgtgttggtggtgggtcg
aatgccatcggtctcttccatccctttgtagaagatgagtcagtagccatgtatggagct
gaagcggctggatttggtgtggatacggagcaccacgcagctaccttgaccaagggtcgt
ccaggtgtccttcacggttccctcatggatgtgctccaagatgcccatggtcaaattctt
gaagccttctctatctcagcaggtttggactatcctggtatcggtccagagcattctcac
taccacgatattaaacgtgccagctatgtccctgtgacagacgaagaagccttggaagga
ttccaactcttgtctcgtgtggaagggattatcccagctttggaatctagccatgctatc
gcctttgcggtgaaattggccaaagaacttggaccagaaaagtctatgattgtatgccta
tcaggtcgtggggacaaggatgtggttcaagtaaaagaccgcttggaagcagatgcagca
aagaagggagaagctcatgcctaa

DBGET integrated database retrieval system