KEGG   Streptococcus pneumoniae TCH8431/19A: HMPREF0837_12078Help
Entry
HMPREF0837_12078  CDS       T01259                                 

Definition
(GenBank) GroES-like protein
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
snc  Streptococcus pneumoniae TCH8431/19A
Pathway
snc00010  Glycolysis / Gluconeogenesis
snc00625  Chloroalkane and chloroalkene degradation
snc00626  Naphthalene degradation
snc01100  Metabolic pathways
snc01110  Biosynthesis of secondary metabolites
snc01120  Microbial metabolism in diverse environments
snc01130  Biosynthesis of antibiotics
snc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:snc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HMPREF0837_12078
  Lipid metabolism
   00071 Fatty acid degradation
    HMPREF0837_12078
  Amino acid metabolism
   00350 Tyrosine metabolism
    HMPREF0837_12078
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    HMPREF0837_12078
   00626 Naphthalene degradation
    HMPREF0837_12078
Enzymes [BR:snc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     HMPREF0837_12078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C AlaDh_PNT_C Sacchrp_dh_NADP Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: ADI70306
UniProt: D6ZNI3
Position
complement(1906010..1907047)
Genome map
AA seq 345 aa AA seqDB search
MKSAVYTKAGQVGLASIERPQIIEADDVIIRVVRACVCGSDLWRYRNPETKAGHKNSGHE
AIGIVEEAGEAITTVKPGDFVIVPFTHGCGECDACLAGFDGSCDNHIGNNLGGDFQAEYI
RFHYANWALVKIPGQPSDYTEGMLKSLLTLADVMPTGYHAARVANVQKGDKVVVIGDGAV
GQCAVIAAKMRGASQIILMSRHEDRQKMAMESGATAVVAERGQEGITKVREILGGGADAA
LECVGTEAAIEQALGVLHNGGRMGFVGVPHYNNRALGSTFMQNISVAGGAASATTYDKQF
LLKAVLDGDINPGRVFTSSYKLEDIDQAYKDMDERKTIKSMIVIE
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcagcagtatatacaaaggcaggtcaggttggacttgctagcattgaacgtccg
caaataatagaagcggatgatgtgattattcgtgtggttcgtgcgtgcgtttgtggttca
gatttatggaggtaccgtaatccagaaacgaaagctggacataaaaatagtggacacgaa
gcgattgggattgttgaagaagctggggaagccattacgacggtgaaaccaggtgatttt
gtgattgtcccttttacacatggatgtggtgagtgtgatgcctgtcttgctggatttgac
ggttcttgcgacaatcatattggtaataatttggggggtgattttcaggcagaatatatt
cgcttccactatgcaaactgggcgctggttaaaatccctggtcaaccttctgattataca
gaagggatgctcaagtcccttttgactcttgcagatgtcatgccgacaggctatcatgca
gcgcgtgttgcaaatgttcaaaaaggggacaaggttgttgttatcggtgatggggctgtt
ggtcaatgtgctgtcatcgcggctaagatgcgtggagcatcacaaattatccttatgagc
cgtcatgaagaccgtcaaaagatggctatggagtcaggtgcgacagctgttgttgcagaa
cgtggtcaagaaggaattaccaaggtgcgtgaaatcctcggcggaggagcagacgcagca
cttgaatgtgttggtacggaggctgctatagaacaggcgctaggtgttcttcataatgga
gggcgtatgggttttgtaggagtcccacactataataatcgtgctcttggttcgacattt
atgcaaaatatctctgtagcaggtggggcagcttctgctacaacatacgataagcaattt
ttactaaaagccgtccttgatggtgatatcaatccaggtcgcgtctttacttcaagttat
aaactggaagatatcgaccaagcctataaagatatggatgaacgtaagacaattaagtct
atgattgtaatcgaataa

DBGET integrated database retrieval system