KEGG   Streptococcus pneumoniae ST556: MYY_0370Help
Entry
MYY_0370          CDS       T02087                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
snd  Streptococcus pneumoniae ST556
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:snd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MYY_0370
Enzymes [BR:snd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     MYY_0370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
338628..339182
Genome map
AA seq 184 aa AA seqDB search
MDTQKIEAAVKMIIEAVGENVNREGLQETPARVARMYQEIFSGLGQTAEEHLSKSFEIID
DNMVVEKDIFFHTMCEHHFLPFYGRAHIAYIPDGRVAGLSKLARTVEVYSKKPQIQERLN
IEVADALMDYLGAKGAFVVIEAEHMCMSMRGVRKPGTATLTTVARGLFETDKDLRDQAYR
LMGL
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggatacacaaaagattgaagcagctgtaaaaatgattatcgaggctgtaggagagaac
gttaatcgcgagggcttgcaggaaacacctgctcgtgtagcccgtatgtatcaagagatt
ttttcaggtcttggtcaaacagcagaggaacatttgtcaaaatcctttgaaattattgac
gataatatggtggtagaaaaggatatctttttccataccatgtgtgaacaccacttcttg
ccattttatggtagagcgcacattgcctacattccagatggtcgtgtggcaggcttgtct
aagctagcccgtacggttgaagtttattcgaaaaaaccacaaattcaagaacgtttgaat
atcgaagtggccgatgccttgatggactatctaggtgctaaaggagcctttgttgtcatt
gaggcggaacatatgtgtatgagtatgcgtggtgttagaaaaccaggcactgcaaccttg
acgacagtagctcgtggtctatttgaaacagataaggatctccgtgaccaagcttatcgt
ttaatggggctataa

DBGET integrated database retrieval system