KEGG   Streptococcus pneumoniae ST556: MYY_0438Help
Entry
MYY_0438          CDS       T02087                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
snd  Streptococcus pneumoniae ST556
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:snd00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    MYY_0438
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MYY_0438
Enzymes [BR:snd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     MYY_0438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
404428..405024
Genome map
AA seq 198 aa AA seqDB search
MTDNFFGKTLAARKVEAIPGMLEFDIPVHRDNRGWFKENFQKEKMLPLGFPESFFAEGKL
QNNVSFSRKNVLRGLHAEPWDKYISVADGGKVLGSWVDLREGETFGNTYQTVIDASKGIF
VPRGVANGFQVLSDTVSYSYLVNDYWALELKPKYAFVNYADPSLGIEWENIAEAEVSEAD
KHHPLLKDVKPLKKEDLE
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgacagataattttttcggtaagacgcttgcggcacgcaaggttgaagctattccaggc
atgttggagtttgatatccccgttcatagagataatcgtggctggtttaaagaaaatttc
caaaaggaaaaaatgcttccacttggatttccagagtctttctttgcagaaggaaaattg
caaaacaatgtatccttctcacgtaaaaatgtccttcgaggtctccacgcagagccttgg
gataagtacatctctgtagcagatggagggaaagttctgggttcttgggttgatctacgc
gagggtgaaacctttgggaatacctatcagacagtgattgatgcgagtaagggaatcttt
gttcctcgaggcgtagctaatggcttccaagttttatcagatacagtgtcatatagctat
ctggtcaatgattactgggctcttgaactcaaacccaagtatgcctttgtgaactacgct
gatccaagccttggtattgaatgggaaaatattgcagaagcagaggtttcagaagcagac
aaacatcatccactacttaaggatgtaaaacctttgaaaaaagaagatttggaataa

DBGET integrated database retrieval system