KEGG   Streptococcus pneumoniae ST556: MYY_1078Help
Entry
MYY_1078          CDS       T02087                                 

Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
snd  Streptococcus pneumoniae ST556
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:snd00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MYY_1078
Enzymes [BR:snd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     MYY_1078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1047713..1048303
Genome map
AA seq 196 aa AA seqDB search
MAQLYYRYGTMNSGKTIEILKVAYNYEEQGKGVVIMTSALDTRDGVGYVSSRIGMKRPAL
AIEETTDIFGYIRDLPEKPYCVLVDEAQFLKRHHVYDLARVVDELDIPVMAFGLKNDFRN
ELFEGSKYLLLLADKIDEIKTICQYCKKKATMVLRTQDGLPVYDGEQIQIGGNETYISVC
RKHYFAPEINKENEEK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggcacagttgtattatcgttatgggaccatgaactctggtaaaacgattgagattctc
aaagtggcctataactacgaggagcaaggaaaaggtgttgtcattatgacttcggctctg
gatacgcgtgacggtgttggctatgtgtcgagtcgaattggcatgaaacgccctgccctt
gcgattgaggaaacaacggatatctttggctatatccgagacctaccagaaaaaccttac
tgtgttttggtcgatgaagcccagtttctcaaacgccaccatgtttacgacctagctcgt
gttgtggacgagttagacatacccgtcatggcttttggcttgaaaaatgactttcgcaat
gaattgttcgaaggttccaaatatctcttgcttttagcagacaagattgacgaaatcaag
accatatgtcagtattgcaagaaaaaggcgaccatggtgttgcgaacacaggatggactg
cccgtttacgatggagaacagatccagattggtggtaatgaaacctatatctcggtttgc
cgtaaacattattttgcccctgaaatcaataaggagaatgaagaaaaatga

DBGET integrated database retrieval system