KEGG   Streptococcus pneumoniae ST556: MYY_2078Help
Entry
MYY_2078          CDS       T02087                                 

Definition
L-fucose isomerase
Orthology
K01818  
L-fucose isomerase [EC:5.3.1.25]
Organism
snd  Streptococcus pneumoniae ST556
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:snd00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MYY_2078
Enzymes [BR:snd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.25  L-fucose isomerase
     MYY_2078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2056176..2057942)
Genome map
AA seq 588 aa AA seqDB search
MIQHPRIGIRPTIDGRRQGVRESLEVQTMNMAKSVADLISSTLKYPDGEPVECVISPSTI
GRVPEAAASHELFKKSNVCATITVTPCWCYGSETMDMSPDIPHAIWGFNGTERPGAVYLA
AVLASHAQKGIPAFGIYGRDVQEASDTAIPEDVKEKLLRYARAALATGLMRDTAYLSMGS
VSMGIGGSIVNPDFFQEYLGMRNESVDMTEFTRRMDRGIYDPEEFERAMVWVKEHIKEGV
DRNREDLILSKEEKEKQWEFVIKMFMIGRDLMVGNPRLAELGFEEEAVGHHALVAGFQGQ
RQWTDHFPNGDFMETFLNTQFDWNGIRKPFVFATENDSLNGVSMLFNYLLTNTPQIFADV
RTYWSPEAVKRVTGHTLEGCAAAGFLHLINSGSCTLDGTGQATRDGKPVMKPFWELDESE
VQAMLENTDFPPANREYFRGGGFSTRFLTKGDMPVTMVRLNLLKGVGPVLQIAEGYTLEL
PEDVHHTLDNRTDPGWPTTWFAPRLTGKGAFKSVYDVMNNWGANHGAITYGHIGADLITL
ASMLRIPVNMHNVPEEDIFRPKNWSLFGTEDLESADYRACQLLGPLHK
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgattcaacatccacgtattgggattcgtccgactattgatggtcgtcgtcaaggtgta
cgcgaatcacttgaagtgcaaacaatgaacatggctaaaagtgtggcagatttgatttca
agcacattgaaatatccagatggggaacctgtggaatgcgtgatttctccatctactatt
ggccgtgtaccagaggctgcagcttcccatgagttgtttaaaaaatcaaatgtttgcgca
acaattacagttacaccatgctggtgttatggtagtgaaactatggatatgtctccagat
attcctcatgctatttggggatttaatgggacagaacgcccaggagctgtctatcttgca
gctgtactagcttcacatgctcaaaaagggattccagcctttgggatttatggtagagac
gtccaggaagctagtgatacagctattccagaagatgtcaaagaaaaacttttacgttat
gcgcgtgcagctcttgcaactggcttgatgagagacactgcttacctatcaatgggtagt
gtttcgatggggattggcggttctattgtaaatccggatttcttccaagaatacttagga
atgcgaaatgaatcggtagatatgacggagttcacgcgccgtatggaccgtggtatttac
gaccctgaagagtttgaacgtgctatggtttgggtaaaagaacatatcaaagaaggagtt
gaccgaaatcgtgaggatttgattctttctaaagaagagaaagaaaaacaatgggaattt
gttattaagatgttcatgattggacgtgacttaatggttggtaacccaagacttgctgaa
cttggttttgaggaagaagcagttggtcaccatgctttagtagctggtttccaaggtcaa
cgtcagtggacagaccatttcccaaatggggactttatggaaactttcctcaatactcag
tttgactggaatggtattcgaaaaccatttgtatttgcgacagagaatgattcactaaat
ggtgtgtctatgctctttaattatctattaacaaatactccacaaatctttgctgatgtg
cgcacttattggagtccagaggctgttaaacgtgtaacgggacatactttagagggttgt
gctgcagctggcttcttacatctaatcaactctggttcttgtacattggatggtacaggg
caagctactcgagatggcaaacctgttatgaaacccttctgggagttggatgaaagtgaa
gtgcaggctatgcttgaaaatacagacttcccaccagcaaaccgcgaatacttccgtgga
ggaggattctcaactcgtttcttgacgaagggggatatgccagtaacaatggtacgtctc
aatcttctaaaaggggttggtccagtgctacaaattgcagaaggttatacacttgaactt
cctgaagatgttcaccatactttagataatcgtacagatccaggatggccaactacttgg
tttgctccacgtttgacaggaaaaggtgctttcaagtctgtctatgacgtcatgaataat
tggggagctaatcacggagccataacatatggccacattggagcagacttgattaccttg
gcttctatgttgagaattcctgtcaatatgcataatgtacccgaggaagatatctttaga
cctaaaaattggtccttatttggaacagaagatctagaatcagcagactatcgtgcatgt
cagttgttgggaccgctacataaataa

DBGET integrated database retrieval system