KEGG   Streptococcus pneumoniae ST556: MYY_2086Help
Entry
MYY_2086          CDS       T02087                                 

Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
snd  Streptococcus pneumoniae ST556
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:snd00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MYY_2086
Enzymes [BR:snd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     MYY_2086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2066409..2067047)
Genome map
AA seq 212 aa AA seqDB search
MSDVKQELIKYGKKLVETDLTKGTGGNLSVFDREKQLMAITPSGIDFFEIKESDIVVMDI
NGNVVEGERLPSSEWYMHLIQYQTRDDIDAIIHAHTTYATVLACLREPLPASHYMIAVAG
KDVRVAEYATYGTKELAVNAAKAMEGRRAVLLANHGILAGAQNLLNAFNIVEEVEYCAKI
YCLAKNFGEPVVLPDEEMDLMAEKFKTYGQRK
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgtaaaacaagaattaattaagtatggcaagaagctagtagaaacagatttg
acgaaaggaacaggtgggaatctcagtgttttcgatcgtgaaaaacaattgatggcaatt
accccgtcgggtattgatttctttgaaatcaaagaatccgatattgtagtgatggatatt
aatggaaatgttgtagagggagaacgcttgccatctagcgaatggtatatgcatttgatt
caataccaaactcgtgatgatatcgatgcaattatccatgctcatacaacttatgcaaca
gtattagcttgtctcagagaaccacttccggctagtcattatatgattgcagtggcaggg
aaagatgttcgggtagctgagtatgcaacatatggtacgaaagaattggctgtgaatgca
gctaaagcaatggaaggtcgtagagcagttttactagcgaatcatggaattttagcaggt
gcacaaaatttattgaatgcatttaatattgttgaagaagttgaatattgtgcaaaaatt
tattgtttagctaagaattttggagagccagtagttcttcctgatgaggagatggattta
atggcagaaaaatttaaaacatacggtcagagaaaatag

DBGET integrated database retrieval system