KEGG   Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage): SPN23F_00730Help
Entry
SPN23F_00730      CDS       T00843                                 

Gene name
strH
Definition
beta-N-acetylhexosaminidase precursor (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
sne  Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sne00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:sne00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(69102..73040)
Genome map
AA seq 1312 aa AA seqDB search
MKHEKQQRFSIRKYAVGAASVLIGFAFQAQTVAADGVTPTTTENQPTIHTVSDSPQSSEN
RTEETPKAELQPEAPKTVETETPATDKVASLPKTEEKPQEEVSSTPSDKAEVVTPTSAEK
ETANKKEEEASPKKEEAKEVDSKESNTDKTDKDKPAKKDEAKAEADKPETETGKERAATV
NEKLAKKKIVSIDAGRKYFSPEQLKEIIDKAKHYGYTDLHLLVGNDGLRFMLDDMSITAN
GKTYASDDVKRAIEKGTNDYYNDPNGNHLTESQMTDLINYAKDKGIGLIPTVNSPGHMDA
ILNAMKELGIQNPNFSYFGKKSARTVDLDNEQAVAFTKALIDKYAAYFAKKTEIFNIGLD
EYANDATDAKGWSVLQADKYYPNEGYPVKGYEKFIAYANDLARIVKSHGLKPMAFNDGIY
YNSDTSFGSFDKDIIVSMWTGGWGGYDVASSKLLAEKGHQILNTNDAWYYVLGRNADGQG
WYNLDQGLNGIKNTPITSVPKTEGADIPIIGGMVAAWADTPSARYSPSHLFKLMRHFANA
NAEYFAADYESAEQALNEVPKDLNRYTAESVAAVKEAEKAIRSLDSNLSRAQQDTIDQAI
AKLQETVNNLTLTPEAQKEEEAKREVEKLAKNKVISIDAGRKYFTLDQLKRIVDKASELG
YSDVHLLLGNDGLRFLLNDMTITANGKTYASDDVKKAIIEGTKAYYDDPNGTALTQAEVT
ELIEYAKSKDIGLIPAINSPGHMDAMLVAMEKLGIKNPQAHFDKVSKTTMDLKNEEAMNF
VKALIGKYMDFFAGKTKIFNFGTDEYANDATSAQGWYYLKWYQLYGKFAEYANTLAAMAK
ERGLQPMAFNDGFYYEDKDDVQFDKDVLISYWSKGWWGYNLASPQYLASKGYKFLNTNGD
WYYVIGNHKQDEAYPLSKAVENSGKVPFNQLASTKYPEVDLPTVGSMLSIWADRPSAEYK
EEEIFELMTAFADHNKDYFRANYNALREELAKIPTNLEGYSKESLEALDAAKTALNYNLN
RNKQAELDTLVANLKAALQGLKPAATHSGSLDENEVAANVETRPELITRTEEIPFEVIKK
ENPNLPAGQENIITAGVKGERTHYISVLTENGKTTETVLDSQVTKEVINQVVEVGAPVTH
KGDESGLAPTTEVKPRLDIQKEEIPFTTVTRENPLLLKGKTQVITKGVNGHRSNFYSVST
SADGKEVKTLVNSVVAQEAVTQIVEVGTMVTHVGDENGQAAIAEEKPRLEIPSQPAPSTA
PAEESKALPQDPAPVVTEKKLPETGTHDSAGLVVAGLMSTLAAYGLTKRKED
NT seq 3939 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatgaaaaacaacagcgtttttctattcgtaaatacgctgtaggagcagcttct
gttctaattggatttgccttccaagcacagactgttgcagccgatggagttactcctact
actacagaaaaccaaccgaccatccatacggtttctgattcccctcaatcatccgaaaat
cggactgaggaaacacctaaagcagagcttcaaccagaagctccaaaaactgtagaaaca
gaaactccagctactgataaggtagctagtcttccaaaaacagaagaaaaaccacaagag
gaagttagttcaactcctagtgataaagcagaggtggtaactccaacttctgctgaaaaa
gaaactgctaataaaaaggaagaagaagctagccctaaaaaggaagaagcgaaagaggtt
gattctaaagagtcaaatacagacaagactgacaaggataaaccagctaaaaaagatgaa
gcgaaagcagaggctgacaaaccggaaacagagacaggaaaggaacgtgctgcaactgta
aatgaaaaactagcgaaaaagaaaattgtttctattgatgctggacgtaaatatttctca
ccagaacagctcaaggaaatcatcgataaagcgaaacattatggctacactgatttacac
ctattagtcggaaatgatggactccgtttcatgttggacgatatgagcatcacagctaac
ggcaagacctatgccagtgacgatgtcaaacgcgccattgaaaaaggtacaaatgattat
tacaacgatccaaacggcaatcacttaacagaaagtcaaatgacagatctgattaactat
gccaaagataaaggtatcggtctcattccgacagtaaatagtcctggacacatggatgcg
attctcaatgccatgaaagaattgggaatccaaaaccctaactttagctattttgggaag
aaatcagcccgtactgtcgatcttgacaacgaacaagctgtcgcttttacaaaagccctt
atcgacaagtatgctgcttatttcgcgaaaaagactgaaatcttcaacatcggacttgat
gaatatgccaatgatgcgacagatgctaaaggttggagtgtgcttcaagctgataaatac
tatccaaacgaaggctaccctgtaaaaggctatgaaaaatttattgcctacgccaatgac
ctcgctcgtattgtaaaatcgcacggtctcaaaccaatggcctttaacgacggtatctac
tacaatagcgacacaagctttggtagttttgacaaagacatcatcgtttctatgtggact
ggtggttggggaggctacgatgtcgcttcttctaaactactagctgaaaaaggtcaccaa
atccttaataccaatgatgcttggtactacgttcttggacgaaacgctgatggccaaggc
tggtacaatctcgatcaggggctcaatggtattaaaaacacaccaatcacttctgtacca
aaaacagaaggagctgatatcccaatcatcggtggtatggtagctgcttgggctgacact
ccatctgcacgttattcaccatcacacctcttcaaactcatgcgtcattttgcaaatgcc
aacgctgaatacttcgcagctgattatgaatctgcagagcaagcacttaacgaggtacca
aaagacctgaaccgttatactgcagaaagcgtcgcggccgtaaaagaagctgaaaaagct
attcgctctctcgatagcaaccttagccgtgcccaacaagatacgattgatcaagccatt
gctaaacttcaagaaactgtcaacaacttgaccctcacgcctgaagctcaaaaagaagaa
gaagctaaacgtgaggttgaaaaacttgccaaaaacaaggtaatctcaatcgatgctgga
cgcaaatactttactctggaccagctcaaacgcatcgtagacaaggccagtgagctcgga
tattctgatgtccatctccttctaggaaatgacggacttcgctttctactcaatgatatg
accattactgccaacggaaaaacctatgctagtgatgacgttaaaaaagctattatcgaa
ggaactaaagcttactacgacgatccaaacggtactgcactaacacaggcagaagtgaca
gagctaattgaatacgctaaatctaaggacattggtctcatcccagctattaacagtcca
ggtcacatggatgctatgctggttgccatggaaaaattaggtattaaaaatcctcaagcc
cactttgataaagtttcaaaaacaactatggacttgaaaaacgaagaagcgatgaacttt
gtaaaagccctcatcggtaaatacatggacttctttgcaggtaaaacaaagattttcaac
tttggtactgacgaatacgccaacgatgcgactagtgcccaaggctggtactacctcaag
tggtatcaactctatggcaaatttgccgaatatgccaacaccctcgcagctatggccaaa
gaaagagggcttcaaccaatggccttcaacgatggcttctactatgaagacaaggacgat
gttcagtttgacaaagatgtcttgatttcttactggtctaaaggctggtggggatataac
ctcgcatcacctcaatacctagcaagcaaaggctataaattcttgaataccaacggtgac
tggtattatgttataggcaatcacaaacaagatgaagcttaccctctttcaaaagcagtt
gaaaattctggtaaagttccattcaatcaactagcttctaccaaatatcctgaagtagat
cttccaacagtcggaagtatgctttcaatctgggcagatagaccaagcgctgagtacaag
gaagaggaaatctttgaactcatgactgcctttgcagaccacaacaaagactacttccgt
gctaattataatgctctccgcgaagaattagctaaaattcctacaaacttagaaggatat
agtaaagaaagtcttgaggcccttgacgcagctaaaacagctctaaattacaacctcaac
cgtaataaacaagctgagcttgacacacttgtagccaacctaaaagccgctcttcaaggc
ctcaaaccagctgcaactcattcaggaagcctggatgaaaatgaagtggctgccaatgtt
gaaaccagaccagaactcatcacaagaactgaagaaattccatttgaagttatcaagaaa
gaaaatcctaacctcccagctggtcaggaaaatattatcacagcaggagtcaaaggtgaa
cgaactcattacatctctgtactcactgaaaatggaaaaacaacagaaacagtccttgat
agccaggtaaccaaagaagttataaaccaagtggttgaagttggcgctcctgtaactcac
aagggtgatgaaagtggtcttgcaccaactactgaggtaaaacctagactggatatccaa
aaagaagaaattccatttaccacagtgactcgtgaaaatccactcttactcaaaggaaaa
acacaagtcattactaagggcgtcaatggacatcgtagcaacttctactctgtgagcact
tctgccgatggtaaggaagtgaaaacacttgtaaatagtgtcgtagcacaggaagccgtt
actcaaatagtcgaagtcggaactatggtaacacatgtaggcgatgaaaacggacaagcc
gctattgctgaagaaaaaccaagactagaaatcccaagccaaccagctccatcaactgct
cctgctgaggaaagcaaagctcttcctcaagatccagctcctgtggtaacagagaaaaaa
cttcctgaaacaggaactcacgattctgcaggactagtagtcgcaggactcatgtccaca
ctagcagcctatggactcactaaaagaaaagaagactaa

DBGET integrated database retrieval system