KEGG   Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage): SPN23F_00750Help
Entry
SPN23F_00750      CDS       T00843                                 

Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
sne  Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage)
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sne00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
74419..76206
Genome map
AA seq 595 aa AA seqDB search
MTRFEIRDDFYLDGKSFKILSGAIHYFRVPPEDWYHSLYNLKALGFNTVETYVAWNLHEP
REGEFHFEGDLDLEKFLQIAQDLGLYAIVRPSPFICAEWEFGGLPAWLLTKNMRIRSSDP
AYIEAVGRYYDQLLPRLVPRLLDNGGNILMMQVENEYGSYGEDKAYLRAIRQLMEECGVT
CPLFTSDGPWRATLKAGTLIEEDLFVTGNFGSKAPYNFSQMQEFFDEHGKKWPLMCMEFW
DGWFNRWKEPIITRDPKELADAVREVLEQGSINLYMFHGGTNFGFMNGCSARGTLDLPQV
TSYDYDALLDEEGNPTAKYLAVKKMMATHFSEYPQLEPLYKESMELDAIPLVEKVSLFET
LDSLSSPVESLYPQKMEELGQSYGYLLYRTETNWDAEEERLRIIDGRDRAQLYVDGQWVK
TQYQTEIGEDIFYQGKKKGLSRLDILIENMGRVNYGHKFLADTQRKGIRTGVCKDLHFLL
NWKHYPLPLDNPEKIDFSKGWTQGQPAFYAYDFTVEEPKDTYLDLSEFGKGVAFVNGQNL
GRFWNVGPTLSLYIPHSYLKEGANRIIIFETEGQYKEEIHLTRKPTLKHIKGENL
NT seq 1788 nt NT seq  +upstreamnt  +downstreamnt
atgacacgatttgagatacgagatgatttctatctcgatggaaaatcatttaagatttta
tctggtgccattcattattttagggttcctccagaggattggtatcattcgctctataac
ttgaaggctcttggttttaatacggtagagacttatgttgcttggaatttacacgagcct
cgtgaaggtgagtttcattttgaaggtgatctggatttagagaaatttctccaaatagcg
caggatttgggtctctacgcaattgtgcgtccgtctccatttatctgtgcggaatgggaa
ttcggtggcttaccagcttggctcttgaccaagaacatgcgaattcgctcatccgaccca
gcatatatcgaggcagttggtcgctactatgatcagttattgccaagactggtgcctcgt
ttgttggacaatggtggcaatattctcatgatgcaggttgaaaatgagtatggttcttac
ggagaagataaggcttacctgagagcgattcgacagctaatggaagagtgtggcgtaacc
tgtcctctctttacatcagatggtccatggcgagctactctgaaagctggaaccttaatt
gaagaggacctctttgtaacaggaaactttggttctaaggcaccttacaacttttcgcag
atgcaggaattctttgatgaacatggtaagaaatggccactcatgtgtatggagttctgg
gatggttggttcaatcgctggaaagaaccgattatcacacgggatcctaaggaattggca
gatgcagttcgagaggttttggaacaaggatctatcaatctttacatgttccacggtggt
acaaactttggtttcatgaatggttgctcggctcgaggaactttggacctgccacaagtt
acgtcttatgattacgatgcccttctggatgaagaaggaaatccaactgctaaatatctt
gcagtcaagaagatgatggcaacacatttttcagagtatccgcagttggaaccactctac
aaagagagtatggagttggatgctattccactagttgaaaaagtttctttgtttgaaacc
ttagatagcttgtcaagtcctgtagaaagtctctatcctcaaaagatggaggagctggga
caaagttatggctacctactttatcgaacagaaacaaactgggatgcagaagaagaaaga
cttcgtatcattgatggtcgagatagggcccagctgtatgtcgatggtcagtgggttaaa
actcaatatcagacagagattggggaagatattttttatcaaggtaaaaagaaagggcta
tctaggttagatatcttgatagaaaatatggggcgtgtcaactatgggcataagttctta
gcggatacgcaacgtaagggaattcggacaggggtctgtaaggatctgcatttcttacta
aactggaaacactatccactcccactagacaatcctgagaaaattgatttttcaaaagga
tggactcaaggacaaccagccttttacgcttatgactttacagtcgaagagccaaaagat
acttacctagacttgtctgagtttggtaagggggttgcctttgtcaatgggcagaatcta
ggacgtttttggaacgttggcccaactctctcactttatatccctcatagctatctcaag
gaaggtgccaaccgcatcattatctttgaaacagaaggtcaatataaagaagagattcat
ttaactcgtaaacctacactaaaacatataaagggggaaaacttatga

DBGET integrated database retrieval system