KEGG   Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage): SPN23F_00810Help
Entry
SPN23F_00810      CDS       T00843                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
sne  Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sne00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sne00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
80360..81397
Genome map
AA seq 345 aa AA seqDB search
MKAYTERVFGNVEGEDVLAYRFETDGGYQLEVMTYGATILRYVAPDKAGNFANVILGFDD
FDSYVGNSPKHGASVGPVAGRIAGATFELNGKTYDLEVNNASNCNHSGSTGWDSSLFEVE
EVSDHGLTLYTERTDGTGGFPGNLKIWISYHLEETGAYEISYKVTTDQDTLVNPTNHSYF
NLSGDFTQTIDRHVFQLNTEGIYSIAPDGVPAKTPEANRDVVKHVYNGTLLKDIFAEEDE
QIQLASGLDHPFALPAGHDNAGFLYDQNSGRFLLFKTEAPCFVVYTANFVDESVIIGGQP
MLQHNGIALEAQALPDAIHSDLKGQVILKAGQTFTSKTRYELVVK
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcatacacagagcgtgtatttggaaatgttgagggtgaggatgtcttggcctat
cgatttgagacagacggtggctaccaacttgaggttatgacttatggtgcgactatcttg
cgctatgtcgcacctgacaaggctggaaattttgccaatgttatcttgggatttgatgac
tttgatagttatgtaggcaatagtcccaagcatggagcaagtgtaggtcctgtagcgggt
cgtattgcaggtgcgacctttgagctcaatggtaagacctatgaccttgaggttaataat
gctagcaactgtaatcacagtggttcaactggttgggattccagcttgtttgaagttgaa
gaagtaagcgatcatggcttgactctctacacagagcgtacagatgggacaggagggttc
cctggaaatctcaagatttggatcagttatcacttggaagaaactggtgcctatgaaatc
agctacaaggtaacgaccgatcaggatacgctggtcaatccaaccaaccacagctatttc
aacttgtctggtgatttcacgcagacgattgaccgtcatgtcttccaactaaacacagag
ggcatttactcaatcgctcctgacggtgttcctgccaaaactccagaagccaaccgtgat
gtggtcaaacacgtctacaatggtaccttgttgaaggatatctttgcagaagaagatgag
caaatccagctggcatcaggtttggatcatccatttgcccttcctgcaggccatgacaat
gctggattcctttatgaccaaaattcaggtcgcttcctgcttttcaagacagaagctcct
tgctttgtggtctacacagcaaactttgtggatgaaagtgtcatcataggaggtcagcca
atgctacagcacaatgggattgctcttgaagcgcaagctttaccagatgccattcacagt
gaccttaaaggccaagtcattcttaaagctggtcaaaccttcaccagtaagacacgttat
gaacttgttgtgaaataa

DBGET integrated database retrieval system