KEGG   Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage): SPN23F_01590Help
Entry
SPN23F_01590      CDS       T00843                                 

Definition
peptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sne  Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage)
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sne01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:sne00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
152000..153373
Genome map
AA seq 457 aa AA seqDB search
MVFPSEQEQIEKFEKDHVAQHYFEVLRTLISKKSVFAQQVGLKEVANYLGEIFKRVGAEV
EIDESYTAPFVMAHFKSSRPDAKTLIFYNHYDTVPADGDQVWTEDPFTLSVRNGFMYGRG
VDDDKGHITARLSALRKYMQHHDDLPVNISFIMEGAEESASTDLDKYLEKHADKLRGADL
LVWEQGTKNALEQLEISGGNKGIVTFDAKVKSADVDIHSSYGGVVESAPWYLLQALQSLR
AADGRILVEGLYEEVQEPNEREMALLETYGQRNPEEVSRIYGLELPLLQEERMAFLKRFF
FDPALNIEGIQSGYQGQGVKTILPAEASAKLEVRLVPGLEPHDVLEKIRKQLDKNGFDKV
ELYYTLGEMSYRSDMSAPAILNVIELAKKFYPQGVSVLPTTAGTGPMHTVFDALEVPMVA
FGLGNANSRDHGGDENVRIADYYTHIELVEELIRSYE
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggtttttcctagcgaacaagaacagattgaaaaatttgaaaaggatcatgtagcccag
cattattttgaggttttgcgtaccttgatttctaagaaatcagtctttgcccagcaggtt
ggactcaaggaagtcgcaaattatctgggtgagattttcaagcgtgttggagctgaagtg
gagattgatgagagctatacagcgccctttgtcatggcacatttcaagagttcgcgtcca
gatgccaagaccttgattttctataaccactatgacactgtgccagcggatggggatcag
gtctggacagaggatccttttacgctttcggtccgcaatggcttcatgtatgggcgtgga
gttgatgacgacaagggtcatatcacagctcgcttgagtgctttgagaaaatatatgcag
caccatgatgatttacctgtcaatatcagctttatcatggagggagcggaggaatcggct
tcaacagacctagataagtatttggaaaagcatgcagacaaactccgtggggcggatttg
ttggtctgggaacaagggaccaaaaatgccttggaacagctggaaatttctggtggcaat
aaggggattgtgacctttgatgccaaggtaaaaagcgctgatgtggatatccactcgagt
tatggtggtgttgtggaatcagctccttggtatctcctccaagccttacagtctcttcgt
gctgcggatggccgtatcttggttgaaggcttgtacgaagaagtacaagagcccaatgaa
cgagaaatggccttgctagaaacttatggtcaacgaaacccagaggaagttagtcggatt
tatggattggagttgcctctcttacaggaggagcggatggcctttctaaaacgtttcttt
ttcgatccagcgcttaatatcgaaggaatccagtctggttatcaaggtcagggtgttaag
actattttacctgcagaagccagtgccaagctagaggttcgtctggttccgggcctagaa
ccgcatgatgttctggaaaaaattcggaaacagctagacaaaaatggctttgataaggta
gaattatactataccttgggagagatgagctatcgaagcgatatgagcgcaccagccatt
ctcaatgtgatcgagttggccaagaaattctatccacagggcgtttcagtcttgccgacg
acagcggggacaggacctatgcatacggtctttgatgccctagaggtaccaatggttgca
ttcggtctaggaaatgccaatagccgagaccacggtggagatgaaaatgtgcgaatcgct
gattattacacccatatcgaattagtagaggagctgattagaagctatgagtag

DBGET integrated database retrieval system