KEGG   Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage): SPN23F_01760Help
Entry
SPN23F_01760      CDS       T00843                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sne  Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sne00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SPN23F_01760 (ruvA)
Enzymes [BR:sne01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SPN23F_01760 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
169765..170358
Genome map
AA seq 197 aa AA seqDB search
MYAYLKGIITKITAKYIVLETNGIGYILHVANPYAYSGQVNQEAQIYVHQVVREDAHLLY
GFRSEDEKKLFLSLISVSGIGPVSALAIIAADDNAGLVQAIETKNITYLTKFPKIGKKTA
QQMVLDLEGKVVVAGDGLPAKVAVQASAENQELEEAMEAMLALGYKATELKKIKKFFEGT
TDTAENYIKSALKMLVK
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtacgcatatttaaaaggaatcattaccaaaattactgccaaatacattgttcttgaa
accaatggtattggttatatcctgcatgtggccaatccttatgcctattcaggtcaggtt
aatcaggaggctcagatttatgtgcatcaggttgtgcgtgaggacgcccatttgctttat
ggatttcgctcagaggatgagaaaaagctctttcttagtctgatttcggtctctgggatt
ggtcctgtatcagctcttgctattatcgctgctgatgacaatgctggcttggttcaagcc
attgaaaccaagaacatcacctacttgaccaagttccctaaaattggcaagaaaacagcc
cagcagatggtgctggacttggaaggcaaggtagtagttgcaggagatggccttcctgcc
aaggtcgcagtgcaagcaagtgctgaaaaccaagaattggaagaagctatggaagccatg
ttggctctgggctacaaggcaacagagctcaagaaaatcaagaaattctttgaaggaacg
acagatacagctgagaactatatcaagtcggcccttaaaatgttggtcaaatag

DBGET integrated database retrieval system