KEGG   Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage): SPN23F_02780Help
Entry
SPN23F_02780      CDS       T00843                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sne  Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sne00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SPN23F_02780 (folP)
Enzymes [BR:sne01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SPN23F_02780 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
264808..265785
Genome map
AA seq 325 aa AA seqDB search
MVKSLEGVTDMSSKANHAKTAICGIINVTPDSFSDGGQFFALEQALQQARKLIAEGASML
DIGGESTRPGSSSYVEIEEEIQRVVPVIKAIRKESDVLISIDTWKSQVAEAALAAGANLV
NDITGLMGDEKMAHVVANAGAKVVIMFNPVMARPQHPSSLIFPHFGFGQAFTEEELADFE
KLPIEELMETFFERALARAEEAGIAQENILLDPGIGFGLTKKENLLLLRDLDKLHQKGYP
IFLGVSRKRFVINILEENGFEVNPETELGFRNRDTASAHVTSIAARQGVEVVRVHDVVSH
RMAVEIASAIRLADEAEDLDLKQYK
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaagccttgagggagtgaccgatatgtcaagtaaagccaatcatgcaaagaca
gctatttgcggaatcatcaatgtaaccccagactccttttcggatggtggtcaatttttt
gctcttgagcaggcacttcagcaggctcgtaaattgatagcagaaggagctagtatgctc
gatatcggcggagaatcgactcggccgggaagtagtagctatgttgagatagaagaggaa
atccagcgtgttgttccagtgattaaagcgattcgcaaggaaagtgatgtcctcatctct
attgatacttggaagagtcaggtagcagaggctgctttggctgctggtgccaatctagtc
aatgatatcactggtctcatgggtgatgaaaaaatggcccatgtggttgcaaatgctgga
gcgaaagtagtcattatgtttaatccagtcatggcgcgacctcagcatcctagctcgctc
atatttcctcattttggttttggacaagcttttacagaggaagagttagctgactttgaa
aaattgccaatcgaagagttgatggagactttttttgaacgagcactagcgagagcagag
gaagctgggattgctcaagaaaacatcctgctggatccaggaattggctttggtctgacc
aagaaagaaaatctgcttcttttacgggatctggataaactacatcagaaaggctatcca
atctttctcggagtgtcgcgcaagcggtttgtcatcaatattcttgaagaaaatggtttt
gaagtcaatcctgagacagaacttggtttccgcaatcgagatacggcttcggctcatgta
accagtatcgctgcgagacagggtgtggaagtggtgcgcgtgcatgatgtagttagtcac
aggatggcagttgaaattgcctccgccattcgtctggctgatgaagcggaagatttagat
ttaaaacaatataaataa

DBGET integrated database retrieval system