KEGG   Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage): SPN23F_02800Help
Entry
SPN23F_02800      CDS       T00843                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
sne  Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sne00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
267090..267644
Genome map
AA seq 184 aa AA seqDB search
MDTQKIEAAVKMIIEAVGEDANREGLQETPARVARMYQEIFSGLGQTAEEHLSKSFEIID
DNMVVEKDIFFHTMCEHHFLPFYGRAHIAYIPDGRVAGLSKLARTVEVYSKKPQIQERLN
IEVADALMEYLGAKGAFVVIEAEHMCMSMRGVRKPGTATLTTVARGLFETDKDLRDQAYR
LMGL
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggatacacaaaagattgaagcagctgtaaaaatgattatcgaggccgtcggagaggac
gctaaccgcgagggcttgcaggaaacacctgctcgtgtggctcgtatgtaccaagagatt
ttttcagggcttggtcaaacagcggaggaacatttgtcaaaatcttttgagattattgac
gataatatggtggtagaaaaggatatctttttccataccatgtgtgaacaccactttctg
ccattttatgggagagcacatattgcctatattccagatggtcgtgtggcaggtttgtct
aagctagcccgtacggttgaagtttattcgaaaaaaccacaaattcaagaacgtttgaat
atcgaagtggccgatgccttgatggagtatctaggtgctaaaggagcctttgttgtcatt
gaggcggaacatatgtgtatgagcatgcgtggtgtcagaaaaccaggcactgcaaccttg
acgacagtagctcgtggtctatttgaaacagataaggacctccgagatcaggcttatcgt
ttaatgggactataa

DBGET integrated database retrieval system