KEGG   Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage): SPN23F_02810Help
Entry
SPN23F_02810      CDS       T00843                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K13940  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:4.1.2.25 2.7.6.3]
Organism
sne  Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sne00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
267803..268615
Genome map
AA seq 270 aa AA seqDB search
MDQLQIKDLEIFAYHGLFPSEKELGQKFVVSAILSYDMTKAATDLDLTASVHYGELCQQW
TTWFQETSEDLIETVAYKLVERTFESYPLVQEMKLELKKPWAPVHLSLDTCSVTIHRRKQ
RAFIALGSNMGDKQANLKQAIDKLRARGIYILKESSVLATEPWGGVEQDSFANQVVEVET
WLPAQDLLETLLAIESELGRVREVHWGPRLIDLDLLFVEDQILYTDDLILPHPYIAERLF
VLESLQEIAPHFIHPILKQPIRNLYDALKK
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggatcaactgcagattaaggatttggaaatttttgcctatcatggtctttttcctagt
gagaaggaattggggcagaaatttgtcgtttcagccatcctatcctatgatatgaccaag
gcagctacagacttggatttaacagcctctgtccattacggagaattgtgtcagcagtgg
acgacttggtttcaggaaacgagtgaagatttgattgaaacggtagcctataaactggtg
gaacgtacctttgagtcttatcctcttgtccaagaaatgaagttggaactgaaaaaacct
tgggcaccggtgcatttgtcactagatacttgctcggtaaccattcatcgccgcaagcaa
cgagcctttatcgccctaggaagcaatatgggagataaacaagcaaacttgaagcaagcc
attgacaaactgcgagctcgtggcatctatattctcaaagagtccagtgtcttagcgacg
gagccttggggtggagtggagcaggatagctttgccaatcaagtggttgaggtggaaacc
tggctaccagcacaagacttgttagaaaccttgttagccattgagtcagagctgggacgg
gtgagagaagtgcattggggacctcgtttgattgatttggacttgctctttgtggaggac
cagatcctttatacagacgacctcatattgcctcatccttacatagcggaacgccttttt
gtccttgagtccttacaggaaattgcgcctcattttatccatccgatattaaaacaaccg
atccgtaacttgtatgatgctttgaaaaaatag

DBGET integrated database retrieval system