KEGG   Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage): SPN23F_03340Help
Entry
SPN23F_03340      CDS       T00843                                 

Gene name
rmlC
Definition
dTDP-4-keto-6-deoxyglucose-3,5-epimerase RmlC (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
sne  Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage)
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sne00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SPN23F_03340 (rmlC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SPN23F_03340 (rmlC)
Enzymes [BR:sne01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     SPN23F_03340 (rmlC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
319640..320233
Genome map
AA seq 197 aa AA seqDB search
MTDNFFGKTLAARKVEAIPCMLEFDIPVHGDNRGWFKENFQKEKMLPLGFPESFFAEGKL
QNNVSFSRKNVLRGLHAEPWDKYISVADGGKVLGSWVDLREGETFGNTYQTVIDASKGIF
VPRGVANGFQVLSDTVSYSYLVNDYWALELKPKYAFVNYADPSLGIEWENIAEAEVSEAD
KNHPLLKDVKPLKKEDL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgacagataattttttcggtaagacgcttgcggcacgcaaggttgaagctattccatgc
atgttggagtttgatatccccgttcatggagataatcgtggctggtttaaagaaaatttc
caaaaggaaaaaatgcttccacttggatttccagagtctttctttgcagaaggaaaattg
caaaacaatgtatccttctcacgtaaaaatgtccttcgaggcctccacgcagagccttgg
gataagtacatctctgtagcagatggagggaaagttctgggttcttgggttgatctacgc
gagggtgaaacctttgggaatacctatcagacagtgattgatgcgagtaagggaatcttt
gttcctcgaggcgtagctaatggcttccaagttttatcagatacagtgtcatatagctat
ctggtcaatgattactgggctcttgaactcaaacccaagtatgcctttgtgaactacgct
gatccaagccttggtattgaatgggaaaatattgcagaagcagaagtttcagaagcagat
aaaaatcatccactacttaaggatgtaaaacctttgaaaaaagaagatttgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system