KEGG   Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage): SPN23F_05830Help
Entry
SPN23F_05830      CDS       T00843                                 

Gene name
bgaA
Definition
surface anchored beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
sne  Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage)
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sne00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SPN23F_05830 (bgaA)
  Lipid metabolism
   00600 Sphingolipid metabolism
    SPN23F_05830 (bgaA)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SPN23F_05830 (bgaA)
Enzymes [BR:sne01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SPN23F_05830 (bgaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
571752..578453
Genome map
AA seq 2233 aa AA seqDB search
MGKGHWNRKRVYSIRKFAVGACSVMIGTCAVLLGGNIAGESVVYADETLITHTAEKPKEE
KMIVEEKADKALETKNVVERTEQSEPSSTEAIASEKKEDEAVTPKEEKVSAKPEEKAPRI
ESQASSQEKPLKEDAKAVTNEEMNQMIEDRKVDFNQNWHFKLNANSKEAIKPDADVSTWK
KLDLPYDWSIFNNFDHESPAQNEGGQLNGGEAWYRKTFKLDEKDLKKNVRLTFDGVYMDS
QVYVNGQLVGHYPNGYNQFSYDITKYLHKDGRENVIAVHAVNKQPSSRWYSGSGIYRDVT
LQVTDKVHVEKNGTTILTPKLEEQQHGKVETHVTSKIVNTDDKDHELVAEYQIVERGGHA
VTGLVRTASRTLKAHESTSLDAILEVERPKLWTVLNDKPALYELITRVYRDGQLVDAKKD
LFGYRYYHWTPNEGFSLNGERIKFHGVSLHHDHGALGAEENYKAEYRRLKQMKEMGVNSI
RTTHNPASEQTLQIAAELGLLVQEEAFDTWYGGKKPYDYGRFFEKDATHPEARKGEKWSD
FDLRTMVERGKNNPAIFMWSIGNEIGEANGDAHSLATVKRLVKVIKDVDKTRYVTMGADK
FRFGNGSGGHEKIADELDAVGFNYSEDNYKALRAKHPKWLIYGSETSSATRTRGSYYRPE
RELKHSNGPERNYEQSDYGNDRVGWGKTATASWTFDRDNAGYAGQFIWTGTDYIGEPTPW
HNQNQTPVKSSYFGIVDTAGIPKHDFYLYQSQWVSVKKKPMVHLLPHWNWENKELASKVA
DSEGKIPVRAYSNASSVELFLNGKSLGLKTFNKKQTSDGRTYQEGANANELYLEWKVAYQ
PGTLEAIARDESGKEIARDKITTAGKPAAVRLIKEDHAIAADGKDLTYIYYEIVDSQGNV
VPTANNLVRFQLHGQGQLVGVDNGEQASRERYKAQADGSWIRKAFNGKGVAIVKSTEQAG
KFTLTAHSDLLKSSQVTVFTGKKEGQEKTVLGTEVPKVQTIIGEAPEMPTTVPFLYSDGS
RAERPVTWSSVDVSKPGIVTVKGMADGREVEARVEVIALKSELPVVKRIAPNTDLNSVDK
SVSYVLTDGSVQEYEVDSWEITEVDKAKLSVAGSRIQMTGQLAGETIHATLVVEEGNAAA
PVVPTVTVGGEAVTGLTSRQPMQYRTLSYGAQLPEVTASAENADVTVLQASAANGMRASI
FVQPKDGGPLQTYAIQLLEEAPKIAHLSLQVEKADSLKEDQTVKLSVRAHYQDGTQAVLP
ADKVTFSTSGEGEVAIRKGMLELHKPGAVTLKAEYEGAKGQVELTIQANTEKKIAQSIRP
VNVVTDLHQKPTLPTTVTVEYDKGFPKAHKVTWQAIPKEKLDSYQTFEVLGKVEGIDLEA
RAKVSVEGIVSVEEVSVTTPIAEAPQLPESVRTYDSNGHVSSAKVAWDAIRPEQYAKEGV
FTVNGRLEGTQLTTKLHVRVSAQTEQGANISDQWTGSELPLAFASDSNPSDPVSNVNDKL
ISYNNQPANRWTNWNRTNPEASVGVLFGDSGILSKRSVDNLSVGFHEDHGVGAPKSYVIE
YYVGKTVPTAPKNPSFVGNEDHVFNDSANWKPVTNLKAPAQLKAGEMNHFSFDKVETYAV
RIRMVRADNKLGTSITEVQIFAKQVAAAKQGQTRIQVDGKDLANFNPDLTDYYLESVDGK
VTAVTASVSNNGLATVVPSVREGEPVRVIAKAENGDILGEYRLHFTKDKNLLSHKPVAAV
KQARLLQVGQALELPTKVPVYFTGKDGYETKNLTVEWEEVPAENLIKAGQFTVRGHVLGS
NLVAEITVRVTDKLGETLSDNPNYDENSNQAFASATNDIDKNSHDRVDYLNDGDHSENRR
WTNWSPTPSSNPEVSAGVIFRENGKIVERTVAQGKVQFFADSGTDAPSKLVLERYVGPEF
EVPTYYSNYQAYDADHPFNNPENWEAVPYRADKDIAAGDEINVTFKDIKAKAMRWRMERK
ADKSGVAMIEMTFLAPSELPQESTQSKILVDGKELADFAENRQDYQITYKGQRPKVSVEE
NNQVASTVVDSGEDSLPVLVRLVSESGKQVKEYRIHLTKEKPVSDKTVAAVQEDLPKLEF
VEKDLAYKTVEKKDSTLYLGETRVEQEGKVGKERIFTAINPDGSKEEKLREVVEVPTDRI
VLVGTKPVAQEAKKPQVSEKADTKPIDSSEASQTNKAQLPNTGSAAGQAAVAAGLALLGL
SAGLVVTKGKKED
NT seq 6702 nt NT seq  +upstreamnt  +downstreamnt
atggggaaaggccattggaatcggaaaagagtttatagcattcgtaagtttgctgtggga
gcttgctcagtaatgattgggacttgtgcagttctattaggaggaaatatagctggagaa
tctgtagtttatgcggatgaaacacttattactcatactgctgagaaacctaaagaggaa
aaaatgatagtagaagaaaaggctgataaagctttggaaactaaaaatgtagttgaaagg
acagaacaaagtgaacctagttcaactgaggctattgcatctgagaagaaagaagatgaa
gccgtaactccaaaagaggaaaaagtgtctgctaaaccggaagaaaaagctccaaggata
gaatcacaagcttcaagtcaagaaaaaccgctcaaggaagatgctaaagctgtaacaaat
gaagaaatgaatcaaatgattgaagacaggaaagtggattttaatcaaaattggcacttt
aaactcaatgcaaattctaaggaagccattaaacctgatgcagacgtatctacgtggaaa
aaattagatttaccgtatgactggagtatctttaacaatttcgatcatgaatctcctgca
caaaatgaaggtggacaactcaacggtggggaagcttggtatcgcaagactttcaaacta
gatgaaaaagacctcaagaaaaatgttcgccttacttttgatggcgtctacatggattct
caagtttatgtcaatggtcagttagtggggcattatccaaatggttataaccagttctca
tatgatatcaccaaataccttcacaaagatggtcgtgagaatgtgattgctgtccatgca
gtcaacaaacagccaagtagccgttggtattcaggaagtggtatctatcgtgatgtgact
ttacaagtgacagataaggtgcatgttgagaaaaatgggacaactattttaacaccaaaa
cttgaagaacaacaacatggcaaggttgaaactcatgtgaccagcaaaatcgtcaatacg
gacgacaaagaccatgaacttgtagccgaatatcaaatcgttgaacgaggtggtcatgct
gtaacaggcttagttcgtacagcgagtcgtaccttaaaagcacatgaatcaacaagccta
gatgcgattttagaagttgaaagaccaaaactctggaccgttttaaatgacaaacctgcc
ttgtacgaattgattacgcgtgtttaccgtgacggtcaattggttgatgctaagaaggat
ttgtttggttaccgttactatcactggactccaaatgaaggtttctctttgaatggtgaa
cgtattaaattccatggagtatccttgcaccacgaccatggggcgcttggagcagaagaa
aactataaagcagaatatcgccgtctcaaacaaatgaaggagatgggagttaactctatc
cgtacaacccacaaccctgctagtgagcaaaccttgcaaatcgcagcagaactaggttta
ctcgttcaggaagaggcctttgatacgtggtatggtggcaagaaaccttatgactatgga
cgtttctttgaaaaagatgccactcacccagaagctcgaaaaggtgaaaaatggtctgat
tttgacctacgtaccatggtcgaaagaggcaaaaacaaccctgctatcttcatgtggtca
attggtaatgaaataggtgaagctaatggtgatgcccactctttagcaactgttaaacgt
ttggtcaaggttatcaaggatgttgataagactcgctatgttaccatgggagcagataaa
ttccgtttcggcaatggtagcggagggcatgagaaaattgctgatgaactcgatgctgtt
ggatttaactattctgaagataattacaaagcccttagagctaagcatccaaaatggttg
atttacggttcagaaacatcatcagcaacccgtacacgaggaagttactatcgccctgaa
cgtgaattgaaacatagcaatggacctgagcgtaattatgaacagtcagattatggaaat
gatcgtgtgggttgggggaaaacagcaaccgcttcatggacttttgaccgtgacaacgct
ggctatgctggacagtttatctggacaggtacggactatattggtgaacctacaccatgg
cacaaccaaaatcaaactcctgttaagagctcttactttggtatcgtagatacagccggc
attccaaaacatgacttctatctctaccaaagccaatgggtttctgttaagaagaaaccg
atggtacaccttcttcctcactggaactgggaaaacaaagaattagcatccaaagtagct
gactcagaaggtaagattccagttcgtgcttattcgaatgcttctagtgtagaattgttc
ttgaatggaaaatctcttggtcttaagactttcaataaaaaacaaaccagcgatgggcgg
acttaccaagaaggtgcaaatgctaatgaactttatcttgaatggaaagttgcctatcaa
ccaggtaccttggaagcaattgctcgtgatgaatctggcaaggaaattgctcgagataag
attacgactgctggtaagccagcggcagttcgtcttattaaggaagaccatgcgattgca
gcagatggaaaagacttgacttacatctactatgaaattgttgacagccaggggaatgtg
gttccaactgctaataatctggttcgcttccaattgcatggccaaggtcaactggtcggt
gtagataacggagaacaagccagccgtgaacgctataaggcgcaagcagatggttcttgg
attcgtaaagcatttaatggtaaaggtgttgccattgtcaaatcaactgaacaagcaggg
aaattcacccttactgctcactctgatctcttgaaatctagtcaagtcactgtctttact
ggtaagaaagaaggacaagaaaagactgttttggggacagaggtgccaaaagtacagacc
attattggagaggcacctgaaatgcctaccactgttccgtttctatacagtgatggtagt
cgtgcagaacgtcctgtaacctggtcttcagtagatgtgagcaagcctggtattgtaacg
gtgaaaggtatggctgacggacgagaagtagaagctcgtgtagaagtgattgctcttaaa
tcagagctaccagttgtgaaacgtattgctccaaatactgacttgaattctgtagacaaa
tctgtttcctatgttttgactgatggaagtgtacaagagtacgaagtagatagctgggag
attacggaagtagataaagccaaactttcagtagctggatcacgtattcaaatgactggt
cagttagctggagaaactattcatgcaacccttgtggtagaagaaggaaatgctgcagca
cctgtagtgccaactgttactgttggaggtgaagcagtaacaggtcttactagtcgacaa
ccaatgcaatatcgtactctatcttatggtgcccaattgccagaagtcacagcaagtgct
gaaaatgctgatgtgacagttcttcaagcaagcgcagcaaacggcatgcgtgcaagcata
tttgttcagcctaaagatggtggccctcttcaaacctatgcaattcaattactagaagaa
gcaccaaaaattgctcacttgagcttgcaagtggaaaaagctgacagtctcaaagaagac
caaactgtcaaattgtcggttcgagctcactatcaagatggaacgcaagctgtattacca
gctgataaagtaaccttctctacaagtggtgaaggggaagtcgcaattcgtaaaggaatg
cttgagttgcataagccaggagcagtcactctcaaagcggaatatgagggagctaaaggc
caagttgaactcactatccaagccaatactgagaagaagattgcgcaatctatccgtcct
gtaaatgtagtcacagatttgcatcaaaaacctactcttccaacaacagtaacggttgag
tatgacaaaggtttccctaaagctcacaaagtcacttggcaagctattccgaaagaaaaa
ctagactcctatcaaacatttgaagtactaggtaaagttgaaggaattgaccttgaagcg
cgtgcaaaagtctctgtagaaggtatcgtttcagttgaagaagtcagtgtgacaactcca
atcgcagaagcaccacaattaccagaaagtgttcggacatatgattcaaatggtcacgtt
tcatcagctaaggttgcatgggatgcgattcgtccagagcaatacgctaaggaaggtgtc
tttacagttaatggtcgcttagaaggtactcaattaacaactaaacttcatgttcgcgta
tctgctcaaactgagcaaggtgcaaacatttctgaccaatggaccggttcagaattgcca
cttgcctttgcttcagactcaaatccaagcgacccagtttcaaatgttaatgacaagctc
atttcctacaataaccaaccagccaatcgttggacaaactggaatcgtactaatccagaa
gcttcagtcggtgtcctattcggagattcaggtattttgagcaaacgttcagttgataac
ttaagcgttggcttccatgaagaccatggagttggtgcaccgaagtcttatgtgattgag
tattatgttggtaagactgtcccaacagctcctaaaaaccctagttttgttggtaatgag
gaccatgtctttaatgattctgccaactggaaaccagttactaatctaaaagcccctgct
caactcaaggctggagaaatgaaccactttagctttgataaagttgaaacctatgctgtt
cgtattcgcatggtgagagcagacaacaaactaggaacgtctatcacagaggtacaaatc
tttgcgaaacaagttgcggcagccaagcaaggacaaacaagaatccaagttgacggtaaa
gacttagcaaacttcaaccctgatttgacagactactaccttgagtctgtagatggaaaa
gttacggcagtcacagcaagtgttagcaacaatggcctcgctaccgtcgttccaagcgtt
cgtgaaggtgagccggttcgtgtcatcgcgaaagctgaaaatggcgacatcttaggagaa
taccgtctgcacttcactaaggataagaacttactttctcataaaccagttgctgcggtt
aaacaagctcgcttgctacaagtaggtcaagcacttgaattgccgactaaggttccagtt
tacttcacaggtaaagacggctacgaaacaaaaaacctgacagttgaatgggaagaagtt
ccagcggaaaatctgataaaagcaggtcaatttaccgttcgaggccatgtccttggtagt
aaccttgttgctgagatcactgtacgagtgacagacaaacttggtgagactctttcagat
aaccctaactatgatgaaaacagtaaccaggcctttgcttcagcaaccaatgatattgac
aaaaactctcatgaccgcgttgactatctcaatgacggagatcattcagaaaatcgtcgt
tggacaaactggtcaccaacaccatcttctaatccagaagtatcagcgggtgtgattttc
cgtgaaaatggtaagattgtagaacggactgttgcacaaggaaaagttcagttctttgca
gatagtggtacggatgcaccatctaaactcgttttagaacgctatgtcggtccagagttt
gaagtgccaacctactattcaaactaccaagcctacgacgcagaccatccattcaacaat
ccagaaaattgggaagctgttccttatcgtgcggataaagacattgcagctggtgatgaa
atcaacgtaacatttaaagatatcaaagccaaagctatgagatggcgtatggagcgtaaa
gcagataagagcggtgttgcgatgattgagatgaccttccttgcaccaagtgaattgcct
caagaaagcactcaatcaaagattcttgtagatggaaaagaacttgctgatttcgctgaa
aatcgtcaagactatcaaattacctataaaggtcaacggccaaaagtctcagttgaagaa
aacaatcaagtagcttcaactgtggtagatagtggagaagatagccttccagtacttgtt
cgcctcgtttcagaaagtggaaaacaagtcaaggaataccgtatccacttgactaaggaa
aaaccagtttctgataagacagttgctgctgtacaagaagatcttccaaaactcgaattt
gttgaaaaagatttggcatacaagacagttgagaaaaaagattcaacactgtatctaggt
gaaactcgtgtagaacaagaaggaaaagttggaaaagaacgtatctttacagcgattaat
cctgatggaagtaaggaagaaaaactccgtgaagtggtagaagttccgacagaccgcatc
gtcttggttggaaccaaaccagtagctcaagaagctaaaaaaccacaagtgtcagaaaaa
gcagatacaaaaccaattgattcaagtgaagctagtcaaactaataaagcccagttacca
aatacaggtagtgcggcaggccaagcagcagtagcagcaggtttagctcttctaggtttg
agtgcaggattagtagttactaaaggtaaaaaagaagactag

DBGET integrated database retrieval system