KEGG   Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage): SPN23F_06590Help
Entry
SPN23F_06590      CDS       T00843                                 

Definition
glycosyl hydrolase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sne  Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage)
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:sne00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPN23F_06590
Enzymes [BR:sne01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SPN23F_06590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
649241..649522
Genome map
AA seq 93 aa AA seqDB search
MDTPDENGYVADDYRITYLEAHIKAMRDAIYKDGVDLLGYTTWGCIDSVSAGTGEMNKRY
GFIYVDRDNVGNGTLKCSKKKSFYWYMSFIAMV
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atggatacaccggatgagaatggttatgtagcagatgactatcggattacttacttagag
gcccacatcaaggccatgcgagatgccatttacaaagacggggttgacttgcttggttat
acgacatggggctgtatcgattcggtttcagctggcacaggggaaatgaataagcgctat
ggctttatctatgtagatcgagataatgtaggaaatgggactctcaaatgtagcaagaag
aagtccttctattggtacatgtcatttatagcaatggtgtaa

DBGET integrated database retrieval system