KEGG   Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage): SPN23F_16730Help
Entry
SPN23F_16730      CDS       T00843                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
sne  Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sne00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SPN23F_16730 (recR)
DNA repair and recombination proteins [BR:sne03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SPN23F_16730 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1611822..1612418)
Genome map
AA seq 198 aa AA seqDB search
MLYPTPIAKLIDSYSKLPGIGIKTATRLAFYTIGMSADDVNEFAKNLLSAKRELTYCSIC
GRLTDDDPCSICTDSTRDQTTILVLEDSRDVAAMENIQEYHGLYHVLHGLISPMNGISPD
DINLKSLMTRLMDSEVSEVIVATNATADGEATSMYLSRLLKPAGIKVTRLARGLAVGADI
EYADEVTLLRAIENRTEL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgctttatccaacacctattgccaagttgattgacagttattctaagttaccaggtatc
gggattaagacggctacgcgtctggccttttatacgattgggatgtctgctgatgatgtc
aatgaatttgcaaaaaatctcctttctgctaagagagaattgacatattgttctatttgt
ggacgtttgacagacgacgatccttgttctatctgtactgattcgactcgtgaccagaca
acaattttagttcttgaggatagtagagatgtggcagccatggaaaatatccaagaatac
catggactctatcatgtcctgcatggcctcatttctcctatgaatggtatcagtccggac
gatatcaatcttaagagccttatgactcgtcttatggatagtgaggtttcagaagtgatt
gtggcgactaatgctacagcggatggtgaagcgacctccatgtatctttcacgtttgctc
aagccggctggtatcaaggttacgcgtctagcacgaggtctcgctgtgggagcggacatt
gagtatgcggacgaagtgacactcttacgagcgattgaaaatcggacagagttgtaa

DBGET integrated database retrieval system