KEGG   Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage): SPN23F_18700Help
Entry
SPN23F_18700      CDS       T00843                                 

Definition
zinc-binding dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
sne  Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage)
Pathway
Glycolysis / Gluconeogenesis
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sne00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SPN23F_18700
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPN23F_18700
  Lipid metabolism
   00071 Fatty acid degradation
    SPN23F_18700
  Amino acid metabolism
   00350 Tyrosine metabolism
    SPN23F_18700
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SPN23F_18700
   00626 Naphthalene degradation
    SPN23F_18700
Enzymes [BR:sne01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SPN23F_18700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1817528..1818565)
Genome map
AA seq 345 aa AA seqDB search
MKSAVYTKAGQVGLASIERPQIIEADDVIIRVVRACVCGSDLWRYRNPETKAGHKNSGHE
AIGIVEEAGEAITTVKPGDFVIVPFTHGCGECDACLAGFDGSCDNHIGNNLGGDFQAEYI
RFHYANWALVKIPGQPSDYTEGMLKSLLTLADVMPTGYHAARVANVQKGDKVVVIGDGAV
GQCAVIAAKMRGASQIILMSRHEDRQKMAMESGATAVVAERGQEGITKVREILGGGADAA
LECVGTEAAIEQALGVLHNGGRMGFVGVPHYNNRALGSTFMQNISVAGGAASATTYDKQF
LLKAVLDGDINPGRVFTSSYKLEDIDQAYKDMDERKTIKSMIVIE
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcagcagtatatacaaaggcaggtcaggttggacttgctagcattgaacgtccg
caaataatagaagcggatgatgtgattattcgtgtggttcgtgcgtgcgtttgtggttca
gatttatggaggtaccgtaatccagaaacgaaagctggacataaaaatagtggacacgaa
gcgattgggattgttgaagaagctggggaagccattacgacggtgaaaccaggtgatttt
gtgattgtcccttttacacatggatgtggtgagtgtgatgcctgtcttgctggatttgac
ggttcttgcgacaatcatattggtaataatttggggggtgattttcaggcagaatatatt
cgcttccactatgcaaactgggcgctggttaaaatccctggtcaaccttctgattataca
gaagggatgctcaagtcccttttgactcttgcagatgtcatgccgacaggctatcatgca
gcgcgtgttgcaaatgttcaaaaaggggacaaggttgttgttatcggtgatggggctgtt
ggtcaatgtgctgtcatcgcggctaagatgcgtggagcatcacaaattatccttatgagc
cgtcatgaagaccgtcaaaagatggctatggagtcaggtgcgacagctgttgttgcagaa
cgtggtcaagaaggaattaccaaggtgcgtgaaatcctcggcggaggagcagacgcagca
cttgaatgtgttggtacggaggctgctatagaacaggcgctaggtgttcttcataatgga
gggcgtatgggttttgtaggagtcccacactataataatcgtgctcttggttcgacattt
atgcaaaatatctctgtagcaggtggggcagcttctgctacaacatacgataagcaattt
ttactaaaagccgtccttgatggtgatatcaatccaggtcgcgtctttacttcaagttat
aaactggaagatatcgaccaagcctataaagatatggatgaacgtaagacaattaagtct
atgattgtaatcgaataa

DBGET integrated database retrieval system