KEGG   Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage): SPN23F_19120Help
Entry
SPN23F_19120      CDS       T00843                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
sne  Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage)
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sne00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1855807..1857249)
Genome map
AA seq 480 aa AA seqDB search
MPIQNKTMLITYSDSLGNNLKDLYDNLEEHFGDAIGGVHLLPFFPSTGDRGFAPVDYDEV
DSVFGDWEDVKRLGEKYYLMFDFMINHISRQSKYYKDYQEKHEASEFKALFLNWDKFWPE
NRPTQSDVDLIYKRKDRAPKQEIVFEDGSVEHLWNTFGEEQIDLDVTKEVTMEFIRKTIQ
HLASNGCDLIRLDAFAYAVKKLDTNDFFVEPDIWDLLDKVRDIAAEYGTELLPEIHEHYS
IQFKIADHDYYVYDFALPMVTLYTLYSSRTERLAKWLKMSPMKQFTTLDTHDGIGVVDVK
DILTDEEIDYASNELYKVGANVKRKYSSAEYNNLDIYQINSTYYSALGDDDVKYFLARLI
QAFAPGIPQVYYVGLLAGKNDLKLLEETKEGRNINRHYYSNEEIAKEVQRPVVKALLNLF
SFRNHSEAFDLEGTTEIETPTAHSIVIKRQNKDKSVTAVVEIDLQNQTYRVIENGVEVSF
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgccgattcaaaataaaaccatgttgattacctattctgatagccttggaaataatctt
aaagacttatatgataatttggaagagcattttggagatgctattggaggagttcacctt
ttaccatttttcccatcaacaggtgatcgtggatttgcgccagttgactacgacgaagtg
gactcagtttttggtgattgggaggatgttaagcgtttaggtgagaaatattatcttatg
tttgattttatgattaatcatatttctcgtcaatccaagtattataaggactatcaagaa
aaacatgaagccagtgaatttaaagctctctttttaaactgggataagttttggccagaa
aaccgtccgacacagtctgatgtagatttaatttacaagcgtaaggatcgtgcaccaaag
caagagattgtgtttgaagatggttcagtggaacatttgtggaatacctttggtgaggag
cagattgatcttgatgtgaccaaagaagtaactatggaatttatccgtaagaccattcag
cacttggcaagtaatgggtgtgatttgattcgtctagatgcctttgcttatgcagtgaag
aaattggatactaatgatttctttgtggaaccagatatttgggatttattggacaaagtt
cgagatatcgctgctgagtatgggacagagcttttacctgagattcatgaacactattcg
attcagtttaaaatagcagaccatgattactatgtttatgattttgctcttccaatggtg
acactttatactctttacagttccagaacagagcgtttggctaagtggttaaagatgagc
ccgatgaagcaatttacgacgctagatacccatgatgggattggagtagtagatgtcaag
gatatcctgaccgatgaggagattgactatgcttcaaatgaactctataaggttggagcc
aatgtcaaacgtaagtactctagtgccgagtataacaacttagatatctaccaaatcaat
tcaacctactattcagcgcttggagatgatgatgtcaagtattttctcgctcgtctaatt
caagcttttgccccaggtattcctcaggtttactatgtgggtctattagcaggcaagaat
gacttgaaattattagaagaaactaaagaaggtcgaaatattaatcgtcattactatagc
aacgaggaaatagcaaaagaagtgcaacgacctgttgtgaaggcccttctcaatctattt
tctttccgtaaccattcagaagcctttgatctagaagggactactgagatagagacacca
acagctcacagcattgtaatcaaacgtcaaaataaagataagtccgtaacagcagtagta
gaaattgatttgcaaaatcagacttatcgggtaattgagaatggagttgaagtatcattt
tga

DBGET integrated database retrieval system