KEGG   Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage): SPN23F_21980Help
Entry
SPN23F_21980      CDS       T00843                                 

Gene name
fucA
Definition
L-fuculose phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
sne  Streptococcus pneumoniae ATCC 700669 (serotype 23F ST81 lineage)
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sne00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SPN23F_21980 (fucA)
Enzymes [BR:sne01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     SPN23F_21980 (fucA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2144391..2145029)
Genome map
AA seq 212 aa AA seqDB search
MSDVKQELIKYGKKLVETDLTKGTGGNLSVFDREKQLMAITPSGIDFFEIKESDIVVMDI
NGNVVEGERLPSSEWYMHLIQYQTRDDIDAIIHAHTTYATVLACLREPLPASHYMIAVAG
KDVRVAEYATYGTKELAVNAAKAMEGRRAVLLANHGILAGAQNLLNAFNIVEEVEYCAKI
YCLAKNFGEPVVLPDEEMDLMAEKFKTYGQRK
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatgtaaaacaagaattaattaagtatggcaagaagctagtagaaacagatttg
acgaaaggaacaggtgggaatctcagtgttttcgatcgtgaaaaacaattgatggcaatt
accccgtcgggtattgatttctttgaaatcaaagaatccgatattgtagtgatggatatt
aatggaaatgttgtagagggagaacgcttgccatctagcgaatggtatatgcatttgatt
caatatcaaactcgtgatgatatcgatgcaattatccatgctcatacaacttatgcaaca
gtattagcttgtctcagagaaccacttccggctagtcattatatgattgcagtggcaggg
aaagatgttcgggtagctgagtatgcaacatatggtacgaaagaattggctgtgaatgca
gctaaagcaatggaaggtcgtagagcagttttactagcgaatcatggaattttagcaggt
gcacaaaatttattgaatgcatttaatattgttgaagaagttgaatattgtgcaaaaatt
tattgtttagctaagaattttggagagccagtagttcttcctgatgaggagatggattta
atggcagaaaaatttaaaacatacggtcagagaaaatag

DBGET integrated database retrieval system