KEGG   Simkania negevensis: SNE_A00740Help
Entry
SNE_A00740        CDS       T01559                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sng  Simkania negevensis
Pathway
sng00010  Glycolysis / Gluconeogenesis
sng00052  Galactose metabolism
sng00500  Starch and sucrose metabolism
sng00520  Amino sugar and nucleotide sugar metabolism
sng00521  Streptomycin biosynthesis
sng01100  Metabolic pathways
sng01110  Biosynthesis of secondary metabolites
sng01120  Microbial metabolism in diverse environments
sng01130  Biosynthesis of antibiotics
sng01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sng00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SNE_A00740 (glk)
   00052 Galactose metabolism
    SNE_A00740 (glk)
   00500 Starch and sucrose metabolism
    SNE_A00740 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    SNE_A00740 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SNE_A00740 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SNE_A00740 (glk)
Enzymes [BR:sng01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SNE_A00740 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: CCB87952
UniProt: F8L571
Position
gsn.131:81071..82066
Genome map
AA seq 331 aa AA seqDB search
MSYLAGDIGGTKTHLALYQDQGGKTTCVKNQKFPSKDYPNLRTIVKKFLIGVGLEIERAC
FGIAGPVEDGKSKATNLPWIIDSRLLETELKIKKVALINDLEANAYGLKVLSEDEFFVLN
EGDSNAQGNQAMVSAGTGLGEAGIFFDGKDHFPFACEGGHTDFGPRNEIEDQLLHYLRKK
FEHVSYERILSGPGLYNLYQFVVDTKLEDEDPKTVELINSGDSPRLVSELGLSGDSAACA
KTLQLFASIYGSEAGNAALKFFALGGIFLGGGIAPKILEVLKSGQFMDNFKAKGRFAQLL
STIPVKVVLNDNTALLGSMYYARNLIETGKK
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgtcatatcttgcgggggacattggtggaacaaaaacacacttggcattataccaagac
caaggtggaaaaacaacctgtgtcaaaaatcaaaaatttccaagtaaagattatcccaat
ttaagaactattgtaaaaaaatttttaattggtgttggtctcgaaatcgaacgtgcatgt
tttggaattgcaggacctgttgaagatggaaaaagcaaagcaactaacttgccttggatc
atcgactcacgcctgctcgaaacagaacttaaaattaaaaaagttgccctcatcaatgat
ttagaagctaacgcgtatggcttaaaagttctttctgaagacgaattttttgttctaaac
gaaggtgattccaacgcacaaggcaatcaagcgatggtttctgccggaacaggtcttggt
gaggctggaattttctttgatggaaaagaccattttccatttgcctgtgaaggaggacac
accgattttggtccaagaaatgaaatagaagatcagcttctccactacctgcgtaaaaaa
tttgagcacgtttcttatgaaaggattttgtctggccctgggctttacaacctttatcaa
tttgtcgtggacacgaaactagaagatgaagatcccaaaactgttgaactcattaatagc
ggagattctccgcgacttgtttcagaacttggtctcagtggtgattcagcagcgtgtgcg
aaaactttgcagctttttgcttccatttatggatcagaagcaggcaatgccgcgcttaag
ttttttgcacttggtggtatttttctcggaggaggtattgctcctaaaattttagaagtg
ctcaaaagtggtcagttcatggataactttaaagcaaaaggaaggtttgcacagcttctt
tctacgattcccgtcaaggtggtcctcaatgataatactgccttacttggttcaatgtac
tatgcgcgtaacctcatagaaacaggaaaaaaatga

DBGET integrated database retrieval system