KEGG   Simkania negevensis: SNE_A00740Help
Entry
SNE_A00740        CDS       T01559                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sng  Simkania negevensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sng00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SNE_A00740 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SNE_A00740 (glk)
   00052 Galactose metabolism
    SNE_A00740 (glk)
   00500 Starch and sucrose metabolism
    SNE_A00740 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    SNE_A00740 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SNE_A00740 (glk)
   00524 Butirosin and neomycin biosynthesis
    SNE_A00740 (glk)
Enzymes [BR:sng01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SNE_A00740 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
gsn.131:81071..82066
Genome map
AA seq 331 aa AA seqDB search
MSYLAGDIGGTKTHLALYQDQGGKTTCVKNQKFPSKDYPNLRTIVKKFLIGVGLEIERAC
FGIAGPVEDGKSKATNLPWIIDSRLLETELKIKKVALINDLEANAYGLKVLSEDEFFVLN
EGDSNAQGNQAMVSAGTGLGEAGIFFDGKDHFPFACEGGHTDFGPRNEIEDQLLHYLRKK
FEHVSYERILSGPGLYNLYQFVVDTKLEDEDPKTVELINSGDSPRLVSELGLSGDSAACA
KTLQLFASIYGSEAGNAALKFFALGGIFLGGGIAPKILEVLKSGQFMDNFKAKGRFAQLL
STIPVKVVLNDNTALLGSMYYARNLIETGKK
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgtcatatcttgcgggggacattggtggaacaaaaacacacttggcattataccaagac
caaggtggaaaaacaacctgtgtcaaaaatcaaaaatttccaagtaaagattatcccaat
ttaagaactattgtaaaaaaatttttaattggtgttggtctcgaaatcgaacgtgcatgt
tttggaattgcaggacctgttgaagatggaaaaagcaaagcaactaacttgccttggatc
atcgactcacgcctgctcgaaacagaacttaaaattaaaaaagttgccctcatcaatgat
ttagaagctaacgcgtatggcttaaaagttctttctgaagacgaattttttgttctaaac
gaaggtgattccaacgcacaaggcaatcaagcgatggtttctgccggaacaggtcttggt
gaggctggaattttctttgatggaaaagaccattttccatttgcctgtgaaggaggacac
accgattttggtccaagaaatgaaatagaagatcagcttctccactacctgcgtaaaaaa
tttgagcacgtttcttatgaaaggattttgtctggccctgggctttacaacctttatcaa
tttgtcgtggacacgaaactagaagatgaagatcccaaaactgttgaactcattaatagc
ggagattctccgcgacttgtttcagaacttggtctcagtggtgattcagcagcgtgtgcg
aaaactttgcagctttttgcttccatttatggatcagaagcaggcaatgccgcgcttaag
ttttttgcacttggtggtatttttctcggaggaggtattgctcctaaaattttagaagtg
ctcaaaagtggtcagttcatggataactttaaagcaaaaggaaggtttgcacagcttctt
tctacgattcccgtcaaggtggtcctcaatgataatactgccttacttggttcaatgtac
tatgcgcgtaacctcatagaaacaggaaaaaaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system