KEGG   Simkania negevensis: SNE_A03070Help
Entry
SNE_A03070        CDS       T01559                                 

Gene name
gpmA
Definition
2,3-bisphosphoglycerate-independent phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sng  Simkania negevensis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sng00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SNE_A03070 (gpmA)
   01230 Biosynthesis of amino acids
    SNE_A03070 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SNE_A03070 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    SNE_A03070 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SNE_A03070 (gpmA)
Enzymes [BR:sng01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SNE_A03070 (gpmA)
Exosome [BR:sng04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SNE_A03070 (gpmA)
  Exosomal proteins of melanoma cells
   SNE_A03070 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
gsn.131:310219..310941
Genome map
AA seq 240 aa AA seqDB search
MKKCPKLILLRHGQSVWNQRNLFTGWVDIPLSSVGIEEALNAGKRFSAIPIDIIFMSSLI
RAQLTAMLAMSVHSEGKVPVVLHPGEKKQETWAMNYNPKASEMTIPAVKAWEINERMYGE
LQGLDKDETRQKYGAEQVKIWRRSFDTPPPNGESLKMTAERSIPYFKNEIVPHLQEGKNV
LVSAHGNSLRSIVMFLDKLSEKEVLELEIPTGDPICYSFDNGVWKREEIDQVQEAYLKGA
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagtgtccaaaacttattttacttcggcatggccaatcagtctggaaccagcgc
aatctctttaccggatgggttgacatccctctaagctctgttggcatagaagaagccttg
aatgctggaaagaggttttctgccatcccaatcgacatcatctttatgtcttcgcttatt
cgggcgcagcttacagcaatgcttgcaatgagtgtccattctgaaggaaaagttcctgtt
gtattgcaccctggtgaaaaaaaacaagaaacttgggcaatgaattacaaccccaaagct
tctgaaatgaccattcctgcagtaaaagcatgggaaattaatgagcgcatgtatggagaa
ctgcaaggtctcgacaaagatgaaacccgtcaaaagtatggggctgaacaagtaaaaatt
tggcggcgaagctttgacactcctccacctaatggggagagcttgaaaatgactgctgag
cgttccattccatactttaaaaatgaaatcgttcctcatctccaagagggaaaaaatgtt
ttggtttcagcgcacggaaactctcttcgttcgatcgtcatgtttttggataaactttca
gaaaaagaagtcttagaactcgaaattcccacaggtgatcccatttgctatagttttgac
aatggggtatggaaacgcgaagagatagatcaagtccaagaggcctatttgaaaggggca
tga

DBGET integrated database retrieval system