KEGG   Simkania negevensis: SNE_A03690Help
Entry
SNE_A03690        CDS       T01559                                 

Gene name
bfmBB
Definition
lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex (EC:2.3.1.168)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sng  Simkania negevensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sng00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SNE_A03690 (bfmBB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SNE_A03690 (bfmBB)
  Amino acid metabolism
   00310 Lysine degradation
    SNE_A03690 (bfmBB)
Enzymes [BR:sng01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SNE_A03690 (bfmBB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
gsn.131:360328..361512
Genome map
AA seq 394 aa AA seqDB search
MEEEVEVKLPKLGESIVSATVVQWFKKEGDIVKLDEPLLEVSTDKVNSEIPSPVSGRIKA
IHAAPDEELDVGALIATITTAEITSAAPEPQEPKKAEKTATCSSGSSMKSFFTPVVLKIA
QEKGVNLEELANIPATGAGGRLSKRDLEKYLTQKGQKPSSTFASTEQIERMKMTGMRKMI
AENMVRSFYEAPHATLVNEVDITKVVKFIAQEKESFLKKHGYKLSITSFIAKAIASAVKE
FPLINSSLDGDTIVVKRFVNLGIAVSVEQGILVPVIQNCQGRTIPDIAKEVAALSEKARS
NRLDPNQVKEGTITMTNFGMSGTLIGVPIIRYPEVAIVGVGAIQKKVVALDDDTMAIRSM
LHLSLTFDHRVIDGMYGCGFLAAVKQHLEQDISI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagaagttgaagttaaactcccaaagcttggtgaaagtatcgtcagtgcaact
gttgtccagtggtttaaaaaagaaggcgatatcgtcaagctcgatgagcctcttctcgaa
gtttcaacagacaaagtcaacagtgaaataccctcgcctgtttcaggcagaattaaagct
atccatgcagcgcctgatgaagaactcgatgttggcgcattgattgcgacaattacgacc
gctgaaatcacatctgccgcacctgagccacaagagcccaagaaagccgaaaaaaccgct
acgtgttcatccggttcttcaatgaagagttttttcacacccgttgtattaaaaattgcg
caggaaaaaggggtcaatctcgaggaacttgccaacatccctgcgacaggtgctggaggc
cggctctcgaaaagagatctagaaaaatacctaacgcaaaaaggacaaaagccatcatca
acatttgcctcaactgagcaaattgagcggatgaagatgaccggcatgcgcaagatgatt
gctgaaaatatggtccgctccttctacgaagcaccccatgcgacgctcgtgaatgaagtc
gatatcacgaaagttgtcaaattcattgcgcaagaaaaagaaagctttctcaaaaagcat
ggttataaactttctattacgagctttattgctaaagccattgcaagcgccgtgaaagag
tttcctctcattaactcttcccttgatggtgacacgattgttgtgaaacgttttgtcaat
ttagggattgctgtgagcgtcgaacaggggattctcgttcccgtgatccaaaattgccaa
ggacgaacgattccagatattgcaaaagaagtggcagccctttccgaaaaagcccgttca
aatcgactcgatccaaaccaagtgaaggaaggaacgattactatgaccaactttggaatg
tctggaacccttatcggggtgccgatcattcgttatccagaagttgccattgttggagtc
ggagcgattcaaaagaaagtcgttgctcttgatgacgatactatggcaatccgttcgatg
ttgcatctctcgcttacatttgatcaccgagtgattgatggaatgtatggctgcggcttt
ttagcagcagtgaaacagcatctagagcaagatatcagcatttaa

DBGET integrated database retrieval system