KEGG   Simkania negevensis: SNE_A03690Help
Entry
SNE_A03690        CDS       T01559                                 

Gene name
bfmBB
Definition
lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex (EC:2.3.1.168)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sng  Simkania negevensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sng00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SNE_A03690 (bfmBB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SNE_A03690 (bfmBB)
  Amino acid metabolism
   00310 Lysine degradation
    SNE_A03690 (bfmBB)
Enzymes [BR:sng01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SNE_A03690 (bfmBB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
gsn.131:360328..361512
Genome map
AA seq 394 aa AA seqDB search
MEEEVEVKLPKLGESIVSATVVQWFKKEGDIVKLDEPLLEVSTDKVNSEIPSPVSGRIKA
IHAAPDEELDVGALIATITTAEITSAAPEPQEPKKAEKTATCSSGSSMKSFFTPVVLKIA
QEKGVNLEELANIPATGAGGRLSKRDLEKYLTQKGQKPSSTFASTEQIERMKMTGMRKMI
AENMVRSFYEAPHATLVNEVDITKVVKFIAQEKESFLKKHGYKLSITSFIAKAIASAVKE
FPLINSSLDGDTIVVKRFVNLGIAVSVEQGILVPVIQNCQGRTIPDIAKEVAALSEKARS
NRLDPNQVKEGTITMTNFGMSGTLIGVPIIRYPEVAIVGVGAIQKKVVALDDDTMAIRSM
LHLSLTFDHRVIDGMYGCGFLAAVKQHLEQDISI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagaagttgaagttaaactcccaaagcttggtgaaagtatcgtcagtgcaact
gttgtccagtggtttaaaaaagaaggcgatatcgtcaagctcgatgagcctcttctcgaa
gtttcaacagacaaagtcaacagtgaaataccctcgcctgtttcaggcagaattaaagct
atccatgcagcgcctgatgaagaactcgatgttggcgcattgattgcgacaattacgacc
gctgaaatcacatctgccgcacctgagccacaagagcccaagaaagccgaaaaaaccgct
acgtgttcatccggttcttcaatgaagagttttttcacacccgttgtattaaaaattgcg
caggaaaaaggggtcaatctcgaggaacttgccaacatccctgcgacaggtgctggaggc
cggctctcgaaaagagatctagaaaaatacctaacgcaaaaaggacaaaagccatcatca
acatttgcctcaactgagcaaattgagcggatgaagatgaccggcatgcgcaagatgatt
gctgaaaatatggtccgctccttctacgaagcaccccatgcgacgctcgtgaatgaagtc
gatatcacgaaagttgtcaaattcattgcgcaagaaaaagaaagctttctcaaaaagcat
ggttataaactttctattacgagctttattgctaaagccattgcaagcgccgtgaaagag
tttcctctcattaactcttcccttgatggtgacacgattgttgtgaaacgttttgtcaat
ttagggattgctgtgagcgtcgaacaggggattctcgttcccgtgatccaaaattgccaa
ggacgaacgattccagatattgcaaaagaagtggcagccctttccgaaaaagcccgttca
aatcgactcgatccaaaccaagtgaaggaaggaacgattactatgaccaactttggaatg
tctggaacccttatcggggtgccgatcattcgttatccagaagttgccattgttggagtc
ggagcgattcaaaagaaagtcgttgctcttgatgacgatactatggcaatccgttcgatg
ttgcatctctcgcttacatttgatcaccgagtgattgatggaatgtatggctgcggcttt
ttagcagcagtgaaacagcatctagagcaagatatcagcatttaa

DBGET integrated database retrieval system