KEGG   Simkania negevensis: SNE_A05160Help
Entry
SNE_A05160        CDS       T01559                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
sng  Simkania negevensis
Pathway
sng00900  Terpenoid backbone biosynthesis
sng01100  Metabolic pathways
sng01110  Biosynthesis of secondary metabolites
sng01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sng00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SNE_A05160 (dxr)
Enzymes [BR:sng01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     SNE_A05160 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXP_reductoisom DXPR_C Semialdhyde_dh NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: CCB88393
UniProt: F8L6P5
Position
gsn.131:532177..533319
Genome map
AA seq 380 aa AA seqDB search
MKKKQIALLGSTGSIGQSTLKVAAHLKDKIQVVALAAHSNIDRLEEQARMFHPEVLAVYD
VNKALELEKRIPHIPVLAGMAGLEAVATHTNVNFVVSAIVGAKGIRPTLKAIEAGKSVGL
ANKEVLIAAGDLIMKRVREKGVSLVPIDSEHSAIFQCLNGEETEGVRRIILTASGGPFRN
YSKEKLTQVTPSCALKHPNWSMGKKVTIDSSTLMNKGLEVIEAHHLFGVNLDQIDVVVHP
QSLIHSFVEFVDGSLLAQMAEHDMIIPIQYALTYPSRAKGIVSCFDFLKYSKLEFYHPDH
ARFPCLGLAYEAARNGGSLPCFMNAVNEVLVDRFLNGAIAWIEIGQKLETLMSRHRICPI
NDLETIFAVDQEARKEAISI
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagaaacaaatcgccttactcggaagcaccggctccataggacagagcactctt
aaagtcgccgctcacctcaaagacaaaattcaggttgtcgcacttgctgcccattcgaat
attgatcgcttagaagagcaagctcgcatgtttcatcctgaggttcttgctgtttatgat
gtaaacaaagctttagagcttgaaaagaggattccccatattcccgttttagcgggaatg
gcaggactcgaagctgtagcaactcatacaaatgtcaactttgtcgtatcagcaattgtt
ggagccaaagggattcggcccactttgaaagcgattgaagctggcaagtcagtgggtttg
gctaataaagaggtgctgattgctgcaggagatcttatcatgaaacgggtgcgagaaaaa
ggtgtttctcttgttccaatcgatagtgagcacagtgcgattttccaatgtctcaatgga
gaagaaaccgagggggtcagacggattattctgacagcatcaggaggaccctttcgtaat
tattcaaaagaaaaattgacccaagtgaccccttcttgtgctctcaaacatcccaactgg
agcatggggaaaaaagtcactatcgactcttccactttgatgaacaaagggctagaggtg
atcgaagctcaccacctttttggggtgaatctcgaccaaattgatgtggtagtccatcct
caaagtttaattcatagttttgtcgagtttgtcgatggatcgctccttgctcaaatggca
gaacacgacatgatcattcccattcagtacgctttgacttatccgagccgcgcaaaagga
attgtctcttgtttcgattttctcaagtattctaaactagaattttatcatccggatcat
gcccggtttccctgtttgggattagcttacgaagcagcaagaaatggggggtctttgccc
tgttttatgaatgctgtcaatgaagtcctcgtcgatcgctttttaaacggtgcgattgcg
tggatagagattgggcaaaagctcgaaacgctgatgagtcgacatcgaatctgtccaatc
aatgatttagaaaccatcttcgctgtggatcaagaagcccgcaaagaagcaataagcata
tag

DBGET integrated database retrieval system