KEGG   Simkania negevensis: SNE_A06120Help
Entry
SNE_A06120        CDS       T01559                                 

Gene name
speB1
Definition
Agmatinase 1 (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
sng  Simkania negevensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sng00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SNE_A06120 (speB1)
Enzymes [BR:sng01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     SNE_A06120 (speB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
gsn.131:650171..651028
Genome map
AA seq 285 aa AA seqDB search
MFLAMNCTLEKGQVVILPVAFDKTTSYGKGTDKGPAALLEASKYIELYDIETDTEMCRAG
IHTAPELRPVTSEEMLKVTYEAVGQYIDQGKFVVTLGGEHSISYAPIRAHAEKYGSLSVL
QLDAHSDLHPALGGNPYSHGSVMARVKTIPEVENVVAVGIRSMAEREKEEMEKEDVFFAH
QLDGEAWMDQVIDRLSDRVYLSFDVDAFDSSLMPSTGTPEPGGLFWNPALKLLKKVIEKR
SLVGFDVVELSPIPGMHAPDYLAAKLVYKILSYLFEPKDSRNGDR
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgtttttagcaatgaattgcacattagaaaaagggcaagttgttatcctgcctgtggct
tttgataaaacaacctcttacggcaaagggaccgataaagggcctgcagctttacttgaa
gcctcaaaatatattgaactctacgatattgaaactgacaccgagatgtgtagagcaggt
attcacacggctccagagctaagacctgtaacaagtgaagaaatgcttaaggttacctat
gaggctgtaggtcagtacatagatcaaggcaagttcgttgttacccttggtggagaacat
tcaatctcttacgcccccattcgtgcccatgctgaaaaatatggctctttaagtgttctt
cagcttgatgcgcatagtgacctccatcccgcgttaggtggaaatccctacagccacggc
tcagtcatggcgcgagttaaaaccattccagaagtagaaaatgtcgttgctgttggaatt
cgaagtatggctgagagggaaaaggaagagatggaaaaagaagatgtttttttcgcccat
caactagatggagaagcttggatggaccaagtgatcgataggctcagtgatcgggtttac
ctctcttttgatgtagatgcttttgattcttcgcttatgccttcaacgggaactcccgaa
ccaggtgggcttttttggaacccagcacttaaactgctgaaaaaagtgattgaaaagcgg
agtctggtgggatttgacgttgtagaactgagtcctatccctgggatgcatgcacctgat
tacttggcagccaaacttgtgtataaaatacttagttatctttttgaacccaaggatagt
agaaatggcgatcgttga

DBGET integrated database retrieval system