KEGG   Simkania negevensis: SNE_A07190Help
Entry
SNE_A07190        CDS       T01559                                 

Gene name
glgB
Definition
(GenBank) 1,4-alpha-glucan-branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sng  Simkania negevensis
Pathway
sng00500  Starch and sucrose metabolism
sng01100  Metabolic pathways
sng01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sng00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SNE_A07190 (glgB)
Enzymes [BR:sng01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SNE_A07190 (glgB)
Exosome [BR:sng04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SNE_A07190 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase Malt_amylase_C Alpha-amylase_C
Motif
Other DBs
NCBI-ProteinID: CCB88596
UniProt: F8L781
Position
gsn.131:750673..752754
Genome map
AA seq 693 aa AA seqDB search
MQKILMKDPHKLLGLHELPEGKVIRLWRPEATEAALEVKGKVCQARAVDTAGLFELMVDS
SIGATDYRITHPSGLEAHDPYSFLPTFSNEDERLFSLGKHEKIAEVMGGRLTIHYGIAGV
KFAVWAPCAQAVSLVGDFNHWNPHLHPMRLMGASGVWELFVPGLKEGEKYKFYILTSEGH
GLFKADPYALQGEMRPNTASVVTRSEEHVWQDHKWLERRTSDAPLKQPLNIYEIHMGSWK
MQGFEFMNYRTVAPHLANYCKEMGYTHVEFMPIMGHPLDESWGYQVTGFYAISSRYGTIA
DFQYLVDYLHQNDIGVIFDWVPGHFPTDLHSIVQFDGTHLYEHQDPRQGYHPHWNTHIFN
YGRFEVINFLIGSALYYLEKMHIDGLRVDAVSSMVYLDYGRKKGEWIPNEKGGNENLEAI
AFLQELNTQVQKKFPGVLMIAEESHAFPGVTKPVSEGGLGFHLKWGLGWMNDTLRFFQTG
FDYRDHRKNLLTHEFTYYFDEQYLLPLSHDEVVHEKKSLLSKMPGNEWEKFANLRLLLSY
MICHPGKKLLFMGGEFGLWKEWNCKEELPWHLIELPMHQKLKCCVRDLNHFYRHHSALWE
EDFSKEGFEWVDTEMTFSYFRHAKNETLLCVHNLTSRKLENVAIPCKNFMPIEIFNTDSQ
EYGGYGILNPNISNACLNLAPFATSILCQKKST
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaatattgatgaaagacccccataaattgcttggactccatgagttgcctgag
ggaaaggtgattcgtctttggcggcctgaagcgactgaggctgcattggaagtgaagggg
aaagtttgccaggcaagagcagtagacactgcggggctatttgagcttatggttgattcc
tcgattggcgcaaccgattaccgtattacccatccgtcaggacttgaagcacacgatccc
tactcctttctcccaacattttccaatgaagatgaacgtcttttttcattagggaagcat
gaaaaaatcgccgaggtgatgggcgggaggctaactattcactatggaatcgctggggtg
aagtttgctgtttgggctccttgtgctcaggcggtttcccttgttggcgattttaatcac
tggaatccccatttgcatccgatgcggctcatgggagcctcgggagtgtgggagcttttt
gttccggggttaaaagaaggggaaaagtacaaattttacatcctcacttctgaagggcat
gggctcttcaaagccgatccctatgccttacaaggggagatgcgacccaacacggcttct
gttgtcacacgcagtgaagagcatgtttggcaagaccataagtggctagaaaggcgaaca
agtgatgctcctttaaaacagccactcaacatctatgaaatccacatgggttcttggaaa
atgcaaggctttgaattcatgaattaccgcacagtagcacctcatcttgccaattactgc
aaagaaatggggtacactcatgtcgaattcatgccaatcatggggcatcctctcgatgag
tcatggggataccaagtgacggggttttatgcgatttcgagccgctatggaacaattgca
gacttccagtatttggtcgattatctccatcaaaacgatattggagtgatttttgattgg
gttcccggccattttccaacagatttacactcgattgtccaatttgatggaacccatctt
tacgaacatcaagatcccagacaggggtatcatccacactggaatactcatatttttaac
tacggccgctttgaagtgatcaattttctcattggaagcgccctttattacctcgaaaag
atgcacattgatggacttcgcgtcgatgctgtttcttcgatggtctatctcgattatggt
cgtaaaaaaggggagtggattccgaacgaaaagggaggcaatgaaaaccttgaagcgatt
gcgtttttgcaagaactcaacacccaagtgcaaaaaaagtttcctggtgttttgatgatt
gcagaagagtctcacgctttcccaggagtgaccaaacctgtttctgaaggagggcttgga
tttcacctcaagtggggtttaggttggatgaacgacaccttaagattttttcaaacggga
tttgactaccgtgatcatcgaaaaaaccttctaacgcatgaattcacctactacttcgac
gaacaatatctcctgcctctttctcatgatgaggttgtgcatgagaaaaaaagcctcctg
tcgaagatgccaggaaatgagtgggaaaaatttgccaatttacgcctgcttttgagctac
atgatctgtcatccaggaaaaaaactccttttcatgggaggggagtttggtctttggaaa
gagtggaattgcaaagaggaacttccgtggcacctgattgaacttccgatgcatcagaag
ctgaaatgttgtgtccgagacctcaatcatttctatcgacaccactctgcactttgggaa
gaagatttttcaaaagaggggtttgaatgggtggataccgaaatgacttttagttatttt
cgtcatgcaaaaaacgagactctcctctgtgttcataatctcacttctcgaaagctagaa
aatgtcgctattccctgtaaaaatttcatgcccattgaaatttttaataccgattcgcaa
gaatatggagggtatggcatactaaacccaaacatcagtaacgcatgtctgaatctagca
ccctttgcaacaagcatcttatgtcaaaaaaagagtacctga

DBGET integrated database retrieval system