KEGG   Simkania negevensis: SNE_A07190Help
Entry
SNE_A07190        CDS       T01559                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sng  Simkania negevensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sng00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
gsn.131:750673..752754
Genome map
AA seq 693 aa AA seqDB search
MQKILMKDPHKLLGLHELPEGKVIRLWRPEATEAALEVKGKVCQARAVDTAGLFELMVDS
SIGATDYRITHPSGLEAHDPYSFLPTFSNEDERLFSLGKHEKIAEVMGGRLTIHYGIAGV
KFAVWAPCAQAVSLVGDFNHWNPHLHPMRLMGASGVWELFVPGLKEGEKYKFYILTSEGH
GLFKADPYALQGEMRPNTASVVTRSEEHVWQDHKWLERRTSDAPLKQPLNIYEIHMGSWK
MQGFEFMNYRTVAPHLANYCKEMGYTHVEFMPIMGHPLDESWGYQVTGFYAISSRYGTIA
DFQYLVDYLHQNDIGVIFDWVPGHFPTDLHSIVQFDGTHLYEHQDPRQGYHPHWNTHIFN
YGRFEVINFLIGSALYYLEKMHIDGLRVDAVSSMVYLDYGRKKGEWIPNEKGGNENLEAI
AFLQELNTQVQKKFPGVLMIAEESHAFPGVTKPVSEGGLGFHLKWGLGWMNDTLRFFQTG
FDYRDHRKNLLTHEFTYYFDEQYLLPLSHDEVVHEKKSLLSKMPGNEWEKFANLRLLLSY
MICHPGKKLLFMGGEFGLWKEWNCKEELPWHLIELPMHQKLKCCVRDLNHFYRHHSALWE
EDFSKEGFEWVDTEMTFSYFRHAKNETLLCVHNLTSRKLENVAIPCKNFMPIEIFNTDSQ
EYGGYGILNPNISNACLNLAPFATSILCQKKST
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaatattgatgaaagacccccataaattgcttggactccatgagttgcctgag
ggaaaggtgattcgtctttggcggcctgaagcgactgaggctgcattggaagtgaagggg
aaagtttgccaggcaagagcagtagacactgcggggctatttgagcttatggttgattcc
tcgattggcgcaaccgattaccgtattacccatccgtcaggacttgaagcacacgatccc
tactcctttctcccaacattttccaatgaagatgaacgtcttttttcattagggaagcat
gaaaaaatcgccgaggtgatgggcgggaggctaactattcactatggaatcgctggggtg
aagtttgctgtttgggctccttgtgctcaggcggtttcccttgttggcgattttaatcac
tggaatccccatttgcatccgatgcggctcatgggagcctcgggagtgtgggagcttttt
gttccggggttaaaagaaggggaaaagtacaaattttacatcctcacttctgaagggcat
gggctcttcaaagccgatccctatgccttacaaggggagatgcgacccaacacggcttct
gttgtcacacgcagtgaagagcatgtttggcaagaccataagtggctagaaaggcgaaca
agtgatgctcctttaaaacagccactcaacatctatgaaatccacatgggttcttggaaa
atgcaaggctttgaattcatgaattaccgcacagtagcacctcatcttgccaattactgc
aaagaaatggggtacactcatgtcgaattcatgccaatcatggggcatcctctcgatgag
tcatggggataccaagtgacggggttttatgcgatttcgagccgctatggaacaattgca
gacttccagtatttggtcgattatctccatcaaaacgatattggagtgatttttgattgg
gttcccggccattttccaacagatttacactcgattgtccaatttgatggaacccatctt
tacgaacatcaagatcccagacaggggtatcatccacactggaatactcatatttttaac
tacggccgctttgaagtgatcaattttctcattggaagcgccctttattacctcgaaaag
atgcacattgatggacttcgcgtcgatgctgtttcttcgatggtctatctcgattatggt
cgtaaaaaaggggagtggattccgaacgaaaagggaggcaatgaaaaccttgaagcgatt
gcgtttttgcaagaactcaacacccaagtgcaaaaaaagtttcctggtgttttgatgatt
gcagaagagtctcacgctttcccaggagtgaccaaacctgtttctgaaggagggcttgga
tttcacctcaagtggggtttaggttggatgaacgacaccttaagattttttcaaacggga
tttgactaccgtgatcatcgaaaaaaccttctaacgcatgaattcacctactacttcgac
gaacaatatctcctgcctctttctcatgatgaggttgtgcatgagaaaaaaagcctcctg
tcgaagatgccaggaaatgagtgggaaaaatttgccaatttacgcctgcttttgagctac
atgatctgtcatccaggaaaaaaactccttttcatgggaggggagtttggtctttggaaa
gagtggaattgcaaagaggaacttccgtggcacctgattgaacttccgatgcatcagaag
ctgaaatgttgtgtccgagacctcaatcatttctatcgacaccactctgcactttgggaa
gaagatttttcaaaagaggggtttgaatgggtggataccgaaatgacttttagttatttt
cgtcatgcaaaaaacgagactctcctctgtgttcataatctcacttctcgaaagctagaa
aatgtcgctattccctgtaaaaatttcatgcccattgaaatttttaataccgattcgcaa
gaatatggagggtatggcatactaaacccaaacatcagtaacgcatgtctgaatctagca
ccctttgcaacaagcatcttatgtcaaaaaaagagtacctga

DBGET integrated database retrieval system