KEGG   Simkania negevensis: SNE_A07650Help
Entry
SNE_A07650        CDS       T01559                                 

Gene name
gmk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
sng  Simkania negevensis
Pathway
sng00230  Purine metabolism
sng01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sng00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SNE_A07650 (gmk)
Enzymes [BR:sng01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     SNE_A07650 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_33 MMR_HSR1 AAA_22 Thymidylate_kin AAA_16 AAA T2SSE AAA_19 AAA_30 KAP_NTPase cobW Viral_helicase1 AAA_25 ABC_tran RNA_helicase
Motif
Other DBs
NCBI-ProteinID: CCB88642
UniProt: F8L7B8
Position
gsn.131:800555..801148
Genome map
AA seq 197 aa AA seqDB search
MRPLLGNVNKGFAIVVSAPAGTGKTTLVRMLIDEFPEVFTQSISCTTRPPRQGEIDGKDY
VFLTDSAFQKRIDRGEFLEHAQVFDHHYGTLKETVEEQRSTGKHVILVIDTQGALAIMGK
LKALFVFVAPPSIEILKERLEKRQTESEEVIQKRLAWAQYEMDQAVHYDYKIVNDDLNTA
YQVLKSIVIAEEHKIRQ
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgcgccctctactaggaaatgtcaataaggggtttgcgattgttgtgagcgctcctgca
gggaccgggaagacaaccttggttcgtatgctgattgatgagttccctgaggtttttacc
caaagcatttcctgcacgacccgacctccaagacagggagagattgatgggaaagattat
gtgtttcttaccgattccgcttttcaaaagagaatcgatcgaggagaatttttggagcat
gctcaggtatttgaccatcattatggaacacttaaagaaacggttgaggagcaaagatca
actgggaaacatgtcattttggtgattgacacccaaggagcattggccattatgggcaag
ctcaaggcgctttttgtttttgtggcacctccttcgatagagattctcaaggagcggctt
gaaaaacgccaaacagaatcagaagaagtcattcaaaagcgtttggcatgggcgcaatat
gaaatggatcaagccgtccattacgattacaaaatcgtgaatgatgatttaaatacggct
taccaagttttaaaaagcattgtcattgccgaagaacataaaattcggcagtaa

DBGET integrated database retrieval system