KEGG   Simkania negevensis: SNE_A07690Help
Entry
SNE_A07690        CDS       T01559                                 

Gene name
yrrC
Definition
hypothetical protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sng  Simkania negevensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sng00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SNE_A07690 (yrrC)
Enzymes [BR:sng01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SNE_A07690 (yrrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
gsn.131:complement(803620..805815)
Genome map
AA seq 731 aa AA seqDB search
MDQLSGYIENIVFSSEENGFTVARLKQPREKDLTTITGTMPGINPGETIHCRGKWKHHPK
HGRQFEVESYELTAPVDVLGIQKYLESGMVKGIGPIYAKRIVEFFGVETLKIIDKFPYRL
LEVPGIGEKRVQQIETCWDEQKSIRRVMIFLQSHKVSPSFARKIFKTYGEDSIEKVTENP
YALARDIFGIGFKTADQLAQNMGIEKDASIRIQAGVEYVLWELSNDGHVCYPIELFLKDA
EAILEVAPEKIRQEIDTLDEAKRIVKGEANKEPSIWIRPLFMAELGIARELKRIHDGECS
IRSVLIDKAVEWAEEKLRMRFAKEQKIAIEKSLSEKLHVVTGGPGTGKSTITRAILSITS
KLTDKITLAAPTGRAAKRLSEITYKKAFTIHSLLEVNFQEGGFKRNKDNPLKCRLLIIDE
ASMIDTQLMYHLLKAIPDETRVIFIGDIDQLPSVGPGTVLKDLIESERISVTRLKHIFRQ
GRGSRIVQSAHRINAGYFPELSYDAESDFNFLEIENPEEILTRTVSLIKKEIPQKFGFDP
INEIQVLSPMKRGLIGIDNFNHILQKELNPQSMQLLRMGRIFQPQDKVMQIRNNYDKHVY
NGDVGRIQEMDLEEQKLTVDFDGKTVSYDFSELDELMLAYAVSIHKYQGSECPCVIIPVH
VSHFKLLFRNLLYTGLTRGKKLVLLLGTKKALAIAINTDNAQKRYTGLRELLSEAIQGQE
SEKSETILINP
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atggatcagctcagtggatacatcgaaaacatcgtctttagcagtgaggaaaatggcttt
actgttgcacggctcaagcagccacgcgaaaaagacctcaccaccattacaggcaccatg
ccagggatcaatccaggcgaaaccattcattgccgcggcaaatggaagcaccaccctaaa
cacggacgtcaatttgaagtcgaaagctatgagctgacagctcctgttgatgttctaggc
atccaaaagtaccttgagtcgggcatggtcaaagggattggtcctatttatgccaaacgg
atcgttgagttttttggagtggaaacactcaagatcatcgacaagtttccctatcggtta
cttgaagttcctggaattggtgaaaaacgggtgcaacaaatcgaaacctgttgggatgag
caaaagtcgatcaggcgcgtcatgatctttttgcaatcgcacaaagtaagcccctctttt
gctcgaaagattttcaaaacatacggggaagatagcatcgaaaaagttaccgaaaatccc
tacgcacttgctcgagatatttttggaattgggtttaagacagctgaccaattagcgcaa
aatatgggaatcgaaaaagacgcctcaattcgtattcaagcaggagttgaatatgtctta
tgggagctcagcaatgatggccatgtttgctaccccatcgaactttttttaaaagatgct
gaagccattttagaggttgcacctgaaaagatccgccaagaaatcgatacgctggatgaa
gccaagcggattgtgaaaggtgaggcaaataaagagccttcgatttggatccgtcccctt
tttatggcagagctcggcattgcccgtgaactcaaacggatacacgatggggaatgttcc
atccggtctgttcttatcgataaagccgtcgaatgggctgaagaaaagttgcggatgaga
tttgccaaggagcaaaaaatcgccatcgaaaagagcctttcagaaaagcttcatgtggta
actggaggacctggaaccgggaaaagtacaatcacaagagccattttgtcgatcacttcc
aaactcaccgacaaaatcacactggctgcaccgacgggacgcgcagccaaacgtcttagc
gaaatcacctacaaaaaagcttttacaatccatagcctgttagaagtcaactttcaggaa
ggtggatttaaacgaaataaagataatcctctcaaatgtcggctcctcattattgatgag
gcaagtatgatcgacactcaactgatgtaccatttgctaaaagctattccggacgaaaca
cgtgttatctttattggagatatcgatcaacttccaagcgtaggtcctggaactgtatta
aaagatttgatcgaatccgagcgaatctccgtcactcggttgaaacacatttttaggcag
gggcgaggttcccgtattgttcaaagcgctcaccgaatcaacgccggttattttcccgaa
ctttcttatgatgctgagagtgactttaactttttagaaatcgaaaatcctgaagagatt
ctaacgcgcactgtctctctgattaaaaaagaaattcctcaaaaatttggttttgatccg
atcaatgaaattcaagtcctctcaccaatgaaacggggactgattggaatcgacaacttc
aatcacatcttgcaaaaagaactcaatcctcaatcgatgcaactcttacgtatgggacgg
atttttcaacctcaagacaaggttatgcaaatccgcaacaactacgataaacatgtctat
aatggagatgtaggacgtatccaagaaatggacctcgaagagcagaagttaaccgttgat
tttgatggaaagacggtctcctacgacttttcagagctcgatgagctcatgctagcctat
gcggtctccatccataagtaccaggggagtgagtgcccctgtgtgatcattcctgtccat
gtgagtcactttaagctcctctttaggaatctcttatacaccgggctcacccgtggcaag
aagctagtccttctcctagggacgaaaaaagccttagccatcgccatcaacacggataat
gcccaaaaaaggtacacaggacttcgagaactcctctcagaagctatacagggacaggag
agcgaaaagtcggaaacaatcttaataaacccttga

DBGET integrated database retrieval system