KEGG   Simkania negevensis: SNE_A07690Help
Entry
SNE_A07690        CDS       T01559                                 

Gene name
yrrC
Definition
(GenBank) uncharacterized protein yrrC
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sng  Simkania negevensis
Pathway
sng03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sng00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SNE_A07690 (yrrC)
Enzymes [BR:sng01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SNE_A07690 (yrrC)
DNA repair and recombination proteins [BR:sng03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SNE_A07690 (yrrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 HHH_4 AAA_19 UvrD_C_2 HHH_5 Viral_helicase1 Helicase_RecD AAA_11 PIF1 PhoH T2SSE HHH_3 HHH_2 RsgA_GTPase IstB_IS21 AAA_22 DUF2075 AAA_16 ABC_tran AAA_28 AAA AAA_18 AAA_29 TrwB_AAD_bind AAA_24 AAA_23
Motif
Other DBs
NCBI-ProteinID: CCB88646
UniProt: F8L7C1
Position
gsn.131:complement(803620..805815)
Genome map
AA seq 731 aa AA seqDB search
MDQLSGYIENIVFSSEENGFTVARLKQPREKDLTTITGTMPGINPGETIHCRGKWKHHPK
HGRQFEVESYELTAPVDVLGIQKYLESGMVKGIGPIYAKRIVEFFGVETLKIIDKFPYRL
LEVPGIGEKRVQQIETCWDEQKSIRRVMIFLQSHKVSPSFARKIFKTYGEDSIEKVTENP
YALARDIFGIGFKTADQLAQNMGIEKDASIRIQAGVEYVLWELSNDGHVCYPIELFLKDA
EAILEVAPEKIRQEIDTLDEAKRIVKGEANKEPSIWIRPLFMAELGIARELKRIHDGECS
IRSVLIDKAVEWAEEKLRMRFAKEQKIAIEKSLSEKLHVVTGGPGTGKSTITRAILSITS
KLTDKITLAAPTGRAAKRLSEITYKKAFTIHSLLEVNFQEGGFKRNKDNPLKCRLLIIDE
ASMIDTQLMYHLLKAIPDETRVIFIGDIDQLPSVGPGTVLKDLIESERISVTRLKHIFRQ
GRGSRIVQSAHRINAGYFPELSYDAESDFNFLEIENPEEILTRTVSLIKKEIPQKFGFDP
INEIQVLSPMKRGLIGIDNFNHILQKELNPQSMQLLRMGRIFQPQDKVMQIRNNYDKHVY
NGDVGRIQEMDLEEQKLTVDFDGKTVSYDFSELDELMLAYAVSIHKYQGSECPCVIIPVH
VSHFKLLFRNLLYTGLTRGKKLVLLLGTKKALAIAINTDNAQKRYTGLRELLSEAIQGQE
SEKSETILINP
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atggatcagctcagtggatacatcgaaaacatcgtctttagcagtgaggaaaatggcttt
actgttgcacggctcaagcagccacgcgaaaaagacctcaccaccattacaggcaccatg
ccagggatcaatccaggcgaaaccattcattgccgcggcaaatggaagcaccaccctaaa
cacggacgtcaatttgaagtcgaaagctatgagctgacagctcctgttgatgttctaggc
atccaaaagtaccttgagtcgggcatggtcaaagggattggtcctatttatgccaaacgg
atcgttgagttttttggagtggaaacactcaagatcatcgacaagtttccctatcggtta
cttgaagttcctggaattggtgaaaaacgggtgcaacaaatcgaaacctgttgggatgag
caaaagtcgatcaggcgcgtcatgatctttttgcaatcgcacaaagtaagcccctctttt
gctcgaaagattttcaaaacatacggggaagatagcatcgaaaaagttaccgaaaatccc
tacgcacttgctcgagatatttttggaattgggtttaagacagctgaccaattagcgcaa
aatatgggaatcgaaaaagacgcctcaattcgtattcaagcaggagttgaatatgtctta
tgggagctcagcaatgatggccatgtttgctaccccatcgaactttttttaaaagatgct
gaagccattttagaggttgcacctgaaaagatccgccaagaaatcgatacgctggatgaa
gccaagcggattgtgaaaggtgaggcaaataaagagccttcgatttggatccgtcccctt
tttatggcagagctcggcattgcccgtgaactcaaacggatacacgatggggaatgttcc
atccggtctgttcttatcgataaagccgtcgaatgggctgaagaaaagttgcggatgaga
tttgccaaggagcaaaaaatcgccatcgaaaagagcctttcagaaaagcttcatgtggta
actggaggacctggaaccgggaaaagtacaatcacaagagccattttgtcgatcacttcc
aaactcaccgacaaaatcacactggctgcaccgacgggacgcgcagccaaacgtcttagc
gaaatcacctacaaaaaagcttttacaatccatagcctgttagaagtcaactttcaggaa
ggtggatttaaacgaaataaagataatcctctcaaatgtcggctcctcattattgatgag
gcaagtatgatcgacactcaactgatgtaccatttgctaaaagctattccggacgaaaca
cgtgttatctttattggagatatcgatcaacttccaagcgtaggtcctggaactgtatta
aaagatttgatcgaatccgagcgaatctccgtcactcggttgaaacacatttttaggcag
gggcgaggttcccgtattgttcaaagcgctcaccgaatcaacgccggttattttcccgaa
ctttcttatgatgctgagagtgactttaactttttagaaatcgaaaatcctgaagagatt
ctaacgcgcactgtctctctgattaaaaaagaaattcctcaaaaatttggttttgatccg
atcaatgaaattcaagtcctctcaccaatgaaacggggactgattggaatcgacaacttc
aatcacatcttgcaaaaagaactcaatcctcaatcgatgcaactcttacgtatgggacgg
atttttcaacctcaagacaaggttatgcaaatccgcaacaactacgataaacatgtctat
aatggagatgtaggacgtatccaagaaatggacctcgaagagcagaagttaaccgttgat
tttgatggaaagacggtctcctacgacttttcagagctcgatgagctcatgctagcctat
gcggtctccatccataagtaccaggggagtgagtgcccctgtgtgatcattcctgtccat
gtgagtcactttaagctcctctttaggaatctcttatacaccgggctcacccgtggcaag
aagctagtccttctcctagggacgaaaaaagccttagccatcgccatcaacacggataat
gcccaaaaaaggtacacaggacttcgagaactcctctcagaagctatacagggacaggag
agcgaaaagtcggaaacaatcttaataaacccttga

DBGET integrated database retrieval system