KEGG   Simkania negevensis: SNE_A08180Help
Entry
SNE_A08180        CDS       T01559                                 

Gene name
recR
Definition
recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
sng  Simkania negevensis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sng03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
gsn.131:complement(849857..850459)
Genome map
AA seq 200 aa AA seqDB search
MAKYPKHLLSLIAQLQKLPGVGKKTAERFAFDLLEWERHDLATLANLLSTLKEKIPHCNQ
CGCLMEEVSCSFCESSKRDPSMMCIIASPRDAFAIEETGNFLGLYHALGTLLSPLDGQTP
EKLNVPKLLKRIELCGVQEVILALDSTLEGDATALFLKEELHQNQIKVSRLALGLPVGSS
LDFIDEGTLSQALSGRQVLH
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atggctaaatatcccaaacatttactttctcttattgctcaactacaaaaactaccaggc
gttggaaaaaaaactgctgagcgattcgcctttgatcttttggagtgggaaagacacgat
ctcgctactctagcaaaccttttgagcaccttaaaagaaaaaatcccccactgcaatcaa
tgtggttgtttaatggaagaggtctcttgctctttttgtgaaagcagtaaaagagatccc
tcaatgatgtgcatcattgcctcaccacgcgatgctttcgcaattgaagaaaccggaaat
tttttgggactctatcacgctttaggaactttattatccccccttgatggccaaactccc
gaaaaattaaacgtgccaaaactcttaaagagaatagagctctgtggggtgcaagaagtg
attcttgcccttgattcaacactagaaggcgatgccacagccctatttctaaaagaagaa
ttgcaccaaaaccagatcaaagtttcaagacttgcacttggattacctgttggaagttca
ctcgattttatcgatgaagggactctttctcaagcattatctggcaggcaagtcttgcat
taa

DBGET integrated database retrieval system