KEGG   Simkania negevensis: SNE_A08910Help
Entry
SNE_A08910        CDS       T01559                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sng  Simkania negevensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sng00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SNE_A08910 (tpiA)
   01230 Biosynthesis of amino acids
    SNE_A08910 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SNE_A08910 (tpiA)
   00051 Fructose and mannose metabolism
    SNE_A08910 (tpiA)
   00562 Inositol phosphate metabolism
    SNE_A08910 (tpiA)
Enzymes [BR:sng01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SNE_A08910 (tpiA)
Exosome [BR:sng04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SNE_A08910 (tpiA)
  Exosomal proteins of bladder cancer cells
   SNE_A08910 (tpiA)
  Exosomal proteins of melanoma cells
   SNE_A08910 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
gsn.131:928123..928890
Genome map
AA seq 255 aa AA seqDB search
MKRRIIIAGNWKMHMSAAETRAFVEQLLPQVKGVSSSVYLAPPFTSIQAATDAALGSAVC
IGAQNMSQYHKGAYTGEVSSMMLKEAGASFVILGHSERRHIFKEDNEMIHSKLKWALEEK
IEPILCIGETQEERDQNRTKEVLETQLGEALKDFSPEEVRKMILAYEPVWAIGTGKTATP
EIAQEAHLLCRSFVAEKCGKEAAEVVPILYGGSVKPENIGELIQKPDIDGALIGGASLEV
DSFAQIIHNVEETLK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgaagaattattattgctgggaactggaagatgcacatgtctgcagccgaaacg
cgtgcatttgtcgagcagcttttgccacaggttaaaggtgtctcatcgagtgtttatctc
gcgccaccattcacatcgatccaggctgcgacggatgctgcgctaggaagcgcagtgtgc
attggggcgcaaaacatgagccagtaccataaaggggcttacacaggagaagtttcctcc
atgatgctaaaagaagcaggagcttcttttgtgattctcggtcactcagaacgacgccac
atttttaaagaagataatgaaatgatccactccaagcttaaatgggccttagaagaaaaa
atcgagcccattctttgcattggtgaaactcaagaagagcgagatcaaaacaggacgaaa
gaggtcttagaaactcaactgggagaagccctaaaagacttttctcccgaagaggtccga
aaaatgattttggcatatgaacctgtctgggcaattgggacagggaaaactgctacacct
gagattgctcaagaggcccacctcctttgtcgcagctttgttgctgaaaagtgtggcaaa
gaagcggcggaagttgtaccgattctctatggaggttcagtcaaaccagagaatattgga
gagcttattcaaaagcccgatatcgatggcgctttaatcggaggagcctcgctcgaagtt
gattcctttgctcaaatcattcacaacgttgaggaaaccttaaaatga

DBGET integrated database retrieval system