KEGG   Simkania negevensis: SNE_A10210Help
Entry
SNE_A10210        CDS       T01559                                 

Gene name
tRPB2
Definition
(GenBank) tryptophan synthase beta chain 2
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sng  Simkania negevensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sng00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SNE_A10210 (tRPB2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SNE_A10210 (tRPB2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SNE_A10210 (tRPB2)
Enzymes [BR:sng01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SNE_A10210 (tRPB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
gsn.131:1052903..1054072
Genome map
AA seq 389 aa AA seqDB search
MKGRYGTFGGAYIPEIFVTPMQDLKKMWETVQSTPQFLAELRHVLKTYAGRPTALTEINH
FAKAIGGPRIFLKREDLLHTGAHKLNNTLGQCLIAKKMGKTRVIAETGAGQHGVATATAC
AFMGMKCVVYMGKKDVIRQAPNVKKMKLLGAEVIPVEKGGQTLKDAINEAMRDWSQTYEE
SHYCLGSALGPHPYPEMVAFFQKVIGEEAKKQLLEQEKCLPDLVVACVGGGSNAIGIFAP
FIEEKSVKLIGVEGGGHSNKLGEHAARFSGGSPGILHGTHSYVLQDENGQIAPTSSISAG
LDYPGVGPEHAHLHETKRAAYVSVTDDEALEAFKLLSKTEGIIPALESAHALAYVMKVAS
RYPKDAIILVNLSGRGEKDLPDLFDRGLL
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggacgttatggtacatttggtggtgcttacattcctgaaatctttgtcactccg
atgcaagatcttaaaaagatgtgggaaacagtccaatcgactcctcagtttttggctgag
ctccgtcacgttttaaaaacctatgcggggcgtcctactgcgcttacagaaatcaatcac
tttgcaaaggccattgggggccctcgtattttcctcaagcgagaagatttgctccatacg
ggcgctcacaaactgaataacacccttggtcaatgccttattgcaaaaaaaatgggaaaa
acccgggtgattgctgaaacaggggcaggacaacatggagtagcgactgcgactgcgtgc
gcttttatgggaatgaagtgcgtcgtttacatggggaaaaaagatgtgattcgccaagcg
cccaatgtgaagaaaatgaagcttcttggcgctgaggttattcctgttgagaaagggggg
caaaccttaaaagatgccatcaatgaagcgatgcgtgattggtcccagacatacgaagaa
agccattactgtttaggttctgcgctcggtccacacccttatcccgaaatggttgctttt
ttccaaaaagtgattggggaagaagcgaaaaaacagctgttagaacaagaaaaatgtttg
ccagatttagtggttgcatgtgttggagggggatctaatgcgattggaatatttgctcct
tttattgaagagaaaagtgtgaaacttattggcgttgaaggaggtggccattctaacaag
cttggagaacatgctgctcgatttagtggtggatcgccgggaattttacatggaacccat
tcgtatgttttacaagatgaaaatgggcagattgctcccacatcttcgatttctgcaggg
cttgactatccaggagttgggcctgagcatgcacatttacatgaaactaaacgggctgcg
tatgtttctgtaacagatgacgaagcactcgaagcatttaaacttttgtcgaagacagaa
gggatcattcctgcacttgaaagtgcgcacgccctggcctacgtcatgaaagttgccagt
aggtatcccaaagatgctattatcttagtcaatctttccggccggggagaaaaagatctc
ccagacctctttgatagggggcttttatga

DBGET integrated database retrieval system