KEGG   Simkania negevensis: SNE_A10220Help
Entry
SNE_A10220        CDS       T01559                                 

Gene name
tRPA
Definition
(GenBank) tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sng  Simkania negevensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sng00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SNE_A10220 (tRPA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SNE_A10220 (tRPA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SNE_A10220 (tRPA)
Enzymes [BR:sng01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SNE_A10220 (tRPA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
gsn.131:1054069..1054830
Genome map
AA seq 253 aa AA seqDB search
MIRELFEKKKAYIGYLTAGDGGLEHTEKMALALVEGGVDLLELGIPFSEPIADGPVIQDA
VERALDAGTTPHQVIELVSRLRKKIAVPIVLMTYFNPIFVAGQEFLKEAKAAGVNGLLIV
DLPPEEADDYLTWMKEAELETIFIVAPSTPEERIPTICRISTGFIYYACRKGTTGMKKGV
PEDLPEKIAQIRRHTDLPIAVGFGVSSAEIAREILTYADGFIVGSFLVQAAHEQTNPIEL
TRLAASLDPRSLL
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgatccgtgaactctttgaaaagaaaaaagcttatattggttacctcacagctggggat
gggggacttgagcatacagaaaaaatggcccttgccctcgttgaagggggcgtcgacctt
ttagaattgggcattcctttttcagaacccattgccgacggtcccgtcattcaagacgct
gttgagcgggccctcgatgctgggaccacacctcaccaggtgatcgaacttgtttctcgt
ttgcgtaagaaaatagctgttccgattgttttaatgacttatttcaaccccatctttgtt
gcaggtcaggaatttttaaaagaggccaaagcagcaggagtgaatgggttgctcattgta
gaccttcctccagaagaagctgatgactatttgacatggatgaaagaggcggagcttgaa
accatctttatcgtggcaccttcaacacccgaagagagaattcctacgatttgcagaatt
tcaacaggctttatttattatgcttgccgaaagggcaccaccggaatgaaaaaaggtgtg
ccagaagatttacccgagaaaattgcccaaatccggcgtcatactgacctgcccatagct
gttggttttggcgtttcttcagcagaaatcgcaagagaaattctcacttatgccgatgga
tttattgtgggttcctttcttgttcaagcggcccatgagcaaaccaatcccatagaattg
acgaggctagcagcctcacttgatcccaggagcttactatga

DBGET integrated database retrieval system