KEGG   Simkania negevensis: SNE_A10220Help
Entry
SNE_A10220        CDS       T01559                                 

Gene name
tRPA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sng  Simkania negevensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sng00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SNE_A10220 (tRPA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SNE_A10220 (tRPA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SNE_A10220 (tRPA)
Enzymes [BR:sng01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SNE_A10220 (tRPA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
gsn.131:1054069..1054830
Genome map
AA seq 253 aa AA seqDB search
MIRELFEKKKAYIGYLTAGDGGLEHTEKMALALVEGGVDLLELGIPFSEPIADGPVIQDA
VERALDAGTTPHQVIELVSRLRKKIAVPIVLMTYFNPIFVAGQEFLKEAKAAGVNGLLIV
DLPPEEADDYLTWMKEAELETIFIVAPSTPEERIPTICRISTGFIYYACRKGTTGMKKGV
PEDLPEKIAQIRRHTDLPIAVGFGVSSAEIAREILTYADGFIVGSFLVQAAHEQTNPIEL
TRLAASLDPRSLL
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgatccgtgaactctttgaaaagaaaaaagcttatattggttacctcacagctggggat
gggggacttgagcatacagaaaaaatggcccttgccctcgttgaagggggcgtcgacctt
ttagaattgggcattcctttttcagaacccattgccgacggtcccgtcattcaagacgct
gttgagcgggccctcgatgctgggaccacacctcaccaggtgatcgaacttgtttctcgt
ttgcgtaagaaaatagctgttccgattgttttaatgacttatttcaaccccatctttgtt
gcaggtcaggaatttttaaaagaggccaaagcagcaggagtgaatgggttgctcattgta
gaccttcctccagaagaagctgatgactatttgacatggatgaaagaggcggagcttgaa
accatctttatcgtggcaccttcaacacccgaagagagaattcctacgatttgcagaatt
tcaacaggctttatttattatgcttgccgaaagggcaccaccggaatgaaaaaaggtgtg
ccagaagatttacccgagaaaattgcccaaatccggcgtcatactgacctgcccatagct
gttggttttggcgtttcttcagcagaaatcgcaagagaaattctcacttatgccgatgga
tttattgtgggttcctttcttgttcaagcggcccatgagcaaaccaatcccatagaattg
acgaggctagcagcctcacttgatcccaggagcttactatga

  All links  
No link information was found.   
DBGET integrated database retrieval system