KEGG   Simkania negevensis: SNE_A11090Help
Entry
SNE_A11090        CDS       T01559                                 

Gene name
sucB
Definition
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sng  Simkania negevensis
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sng00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SNE_A11090 (sucB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SNE_A11090 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    SNE_A11090 (sucB)
Enzymes [BR:sng01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     SNE_A11090 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
gsn.131:1148265..1149398
Genome map
AA seq 377 aa AA seqDB search
MVVEIKVPSAGESVSEAVIATIIKESGSYVEKDEEILELETDKVNHVVHASEAGVLTLHV
KVDETVAIDQVIGTIDPAAKATSAPAAPSAEKKEEPVSPPPASTPSGDGARRTPASFVAS
IGKETAPPPAPKPTPTLAKPAPVKEGSQTRKRMSGLRRTIAKRLVEVKNNTAMLTTFNEV
DMSSVMELRSREKDTFFAKHGVKLGFMSFFVKACVAALKELPDVNAFIDGEEIVYNHSYH
IGISVSTEKGLMVPVIRACNELTFAGIEQAIQDYAKKARSGSISIDDLQGGSFTITNGGV
FGSMLSTPILNPPQSAILGMHNIVKRAVVVNDQIVIRPMMYLALSYDHRIVDGKEAVTFL
VKVKELLEKPDRLLLDF
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggtagtagaaatcaaagttccatcagccggggaatctgtttcagaagctgttattgca
acgatcataaaagagagtggatcatatgtcgaaaaagacgaagaaattctcgagctagaa
actgacaaagtcaaccatgttgtccatgcatccgaagcaggtgtcctgacacttcacgtc
aaagtcgatgaaaccgtagccatcgatcaagtcattggaaccattgatccagcagcaaaa
gcaacttctgcgccagccgctcctagtgccgagaaaaaagaagaaccggtttctccacca
ccagcatcgaccccttcaggcgatggtgctcgacgaacgccagcttcattcgtcgcctcg
attggaaaagaaacggcgccccctccagctccaaaaccaacaccgactttagcaaaaccc
gcgccagttaaagaggggagtcaaacgcgtaaacggatgagtgggcttagacgtacaatc
gccaagcgactcgtcgaagtgaaaaataataccgccatgctcactacttttaacgaagtc
gacatgtcttctgtcatggaacttcggtcgcgtgaaaaagataccttttttgctaagcat
ggggtcaaactcgggttcatgtctttctttgtcaaagcctgtgttgccgccttaaaagag
ctacctgacgttaatgcattcatcgatggtgaggagatcgtctacaatcactcttaccac
attggcatctctgtttcgaccgaaaaaggactcatggttcctgtcatccgcgcctgtaat
gagctgacctttgcagggattgaacaagccattcaagactatgcgaaaaaagcccgctca
ggctctattagcattgacgatcttcaaggaggaagcttcaccatcacaaacgggggagtc
tttggatcgatgctttcaacccccattttaaatccccctcaaagcgccattctagggatg
cataatatcgtcaaacgggctgtcgtcgtgaacgatcaaatcgtcatccgacccatgatg
tatcttgctctcagttacgaccaccgcattgtcgatggcaaagaagccgtcactttctta
gtgaaagtcaaagagctccttgagaaaccagaccgactgcttttagatttttag

  All links  
No link information was found.   
DBGET integrated database retrieval system