KEGG   Simkania negevensis: SNE_A12900Help
Entry
SNE_A12900        CDS       T01559                                 

Definition
putative phosphoketolase (EC:4.1.2.-)
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
sng  Simkania negevensis
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sng00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SNE_A12900
Enzymes [BR:sng01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     SNE_A12900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
gsn.131:1336624..1338963
Genome map
AA seq 779 aa AA seqDB search
MANVDPKRIDALDAYFRACNYLSVGQIYLRSNPLLKEPLKPEHIKKRLLGHWGTSPGLNF
IYAHLNRLIQDTKAKMIYLTGPGHGGPALRANVYLEGCMTETYPDLTQDLSGIEKLMKDF
SHPGGVPSHVSPPTPGSIHEGGELGYSLVHAYGAILDNPELIAVCVVGDGEAETGPLATS
WQSNKFINPKRDGAVLPILHLNGYKISGPTVFGRMPDTKIEQFFKGCGYQPRFIEGDDPK
SLHPVLWKTLDWAYAEIRKKQSEPFDGNPVEWPMIVMRTPKGWTGPKEVDGKKIEGTFRS
HQVPLSDVIEKKDHLEILENWMKSYKPQELFDAAGKPNSNILSIVPPKELRMGSTPHANG
GLLLKELTIPDTADYEVKVPSPGSVIAEATRVLGKLVRDIMKENKDNFRVFCPDETNSNR
FNHVFEVTGRTYLGEIFDSDDDLSHEGRVMEVLSEHLCQGWLEGYLLTGRHGIFPCYEAF
ALIVDSMLNQHGKWLKACQELPWRKPIASLNYLLTSHAWRQDHNGYSHQGPGFIESVMQK
KCSIARIYLPPDANCLLEVGKHCLKSKNYINLIISGKQPMPQWLNMKQAKEHCTKGASIW
DWASNDNGHPDIIMAAAGDIPTLETLAAISILRKKFPDLKIRMVNVVDLFTLMPHSRHPH
GFDEETFASLFGTETPVIFAFHGHPRVIHELTYKRSYPHRFHVRGYIEEGTTTTPFDMVV
CNEMSRFHLAVEALHHLPQMKSVAGDFITECTQKLDDHKVYIYEHGEDIPEVRNWKWEA
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacgtcgatcccaaacgcatcgatgctcttgatgcttactttcgtgcttgtaat
tatctgtcggtgggacaaatttacttgcgctctaacccactgctcaaagagccactcaaa
cctgagcatatcaaaaaacggctcttggggcattggggaacctctcctggactcaacttt
atctatgcccacctcaatcgcttgatccaagatacaaaagcaaaaatgatttatctgaca
ggtcccggtcatggagggcctgccttacgcgctaatgtctacctagaagggtgcatgaca
gaaacctaccccgacctcactcaagatctttcaggaatagaaaaactgatgaaagacttt
tcccatccaggtggagttccaagtcatgtgagccctccaactccaggttcgattcatgaa
ggaggagaacttggctactccctcgtccatgcttacggagccatcttagacaatcccgag
ctgattgctgtttgcgtcgtgggagatggagaagctgaaacgggacctcttgcaacaagt
tggcaatcaaacaagtttatcaacccgaaacgagatggagctgtcttgccgattctacat
ctcaacgggtataaaatctcaggaccaactgtttttggaaggatgcccgacacgaaaatt
gagcaatttttcaaagggtgtggatatcagccccgtttcattgaaggagacgatcctaag
tctcttcaccctgtcctttggaaaacgctcgactgggcttatgctgaaattcgaaaaaaa
caatcggaacctttcgatggaaatcctgtcgaatggccgatgatcgtgatgcgcacccca
aaaggatggacgggccctaaagaagtcgatggaaaaaaaatagaaggcacctttcgctcg
catcaagttcccctctccgatgtcatcgaaaaaaaagaccatcttgaaatcctcgaaaat
tggatgaaaagttacaagccgcaggagctctttgatgcagcaggaaaacccaattcaaac
atcttatctattgttcctccaaaagaactccgcatgggctctacccctcatgcaaatgga
ggccttctcctcaaagaattaaccatcccagacacggcagattacgaagtgaaagtcccg
agcccaggaagtgtgatagccgaagccactcgcgtacttggaaaactcgtgcgggatatc
atgaaagaaaacaaagataactttcgggtcttttgtcctgatgaaaccaattccaaccga
ttcaatcacgtctttgaagtcacaggacgaacttatcttggagaaatttttgatagcgat
gacgacttatctcatgaaggacgtgtcatggaagtgctcagcgaacatctttgtcaagga
tggcttgaagggtatctcctcactggacggcatgggatctttccctgctacgaagccttt
gctctcattgtcgattcgatgctgaaccaacacggaaaatggctcaaagcttgccaagaa
cttccctggagaaagcccattgcctctctcaactatttgctcacttcccatgcatggcgt
caagatcacaatggatacagccatcaaggacctggatttatcgaatctgtcatgcaaaag
aaatgctccattgcccggatctatctccctcctgatgccaactgcttactcgaggtcgga
aaacactgtttaaagagtaaaaactacatcaacttgattatttctggaaaacagcccatg
cctcaatggctaaacatgaaacaagctaaagaacattgcactaaaggagcctctatctgg
gattgggcatccaatgacaatgggcatcccgacatcatcatggcagctgctggtgacatt
ccaactctcgaaacccttgctgctatttcaattctgcgaaaaaaatttcctgatctaaag
atccgcatggtcaatgttgtcgacctcttcacactgatgccccattcgcgtcatcctcac
ggatttgatgaggaaaccttcgcctctctttttggaacagagactcctgttatttttgcc
tttcatggccaccctcgggtcatccacgaactcacctacaagcgctcttatcctcaccga
ttccacgtccggggttacattgaagaaggaacgacaacaacacctttcgatatggttgtt
tgtaatgagatgagccgttttcatttagcagttgaagcgttgcatcacctgccacagatg
aaatccgttgctggagattttattacagaatgcacacagaagctagatgaccataaggtc
tatatttatgaacatggggaagatattcctgaagtccgtaattggaaatgggaggcataa

DBGET integrated database retrieval system