KEGG   Simkania negevensis: SNE_A12900Help
Entry
SNE_A12900        CDS       T01559                                 

Definition
(GenBank) putative phosphoketolase
  KO
K01621  xylulose-5-phosphate/fructose-6-phosphate phosphoketolase [EC:4.1.2.9 4.1.2.22]
Organism
sng  Simkania negevensis
Pathway
sng00030  Pentose phosphate pathway
sng01100  Metabolic pathways
sng01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sng00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SNE_A12900
Enzymes [BR:sng01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     SNE_A12900
    4.1.2.22  fructose-6-phosphate phosphoketolase
     SNE_A12900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: XFP_N XFP_C XFP Gb3_synth Dimeth_Pyl
Motif
Other DBs
NCBI-ProteinID: CCB89167
UniProt: F8L8M7
Position
gsn.131:1336624..1338963
Genome map
AA seq 779 aa AA seqDB search
MANVDPKRIDALDAYFRACNYLSVGQIYLRSNPLLKEPLKPEHIKKRLLGHWGTSPGLNF
IYAHLNRLIQDTKAKMIYLTGPGHGGPALRANVYLEGCMTETYPDLTQDLSGIEKLMKDF
SHPGGVPSHVSPPTPGSIHEGGELGYSLVHAYGAILDNPELIAVCVVGDGEAETGPLATS
WQSNKFINPKRDGAVLPILHLNGYKISGPTVFGRMPDTKIEQFFKGCGYQPRFIEGDDPK
SLHPVLWKTLDWAYAEIRKKQSEPFDGNPVEWPMIVMRTPKGWTGPKEVDGKKIEGTFRS
HQVPLSDVIEKKDHLEILENWMKSYKPQELFDAAGKPNSNILSIVPPKELRMGSTPHANG
GLLLKELTIPDTADYEVKVPSPGSVIAEATRVLGKLVRDIMKENKDNFRVFCPDETNSNR
FNHVFEVTGRTYLGEIFDSDDDLSHEGRVMEVLSEHLCQGWLEGYLLTGRHGIFPCYEAF
ALIVDSMLNQHGKWLKACQELPWRKPIASLNYLLTSHAWRQDHNGYSHQGPGFIESVMQK
KCSIARIYLPPDANCLLEVGKHCLKSKNYINLIISGKQPMPQWLNMKQAKEHCTKGASIW
DWASNDNGHPDIIMAAAGDIPTLETLAAISILRKKFPDLKIRMVNVVDLFTLMPHSRHPH
GFDEETFASLFGTETPVIFAFHGHPRVIHELTYKRSYPHRFHVRGYIEEGTTTTPFDMVV
CNEMSRFHLAVEALHHLPQMKSVAGDFITECTQKLDDHKVYIYEHGEDIPEVRNWKWEA
NT seq 2340 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacgtcgatcccaaacgcatcgatgctcttgatgcttactttcgtgcttgtaat
tatctgtcggtgggacaaatttacttgcgctctaacccactgctcaaagagccactcaaa
cctgagcatatcaaaaaacggctcttggggcattggggaacctctcctggactcaacttt
atctatgcccacctcaatcgcttgatccaagatacaaaagcaaaaatgatttatctgaca
ggtcccggtcatggagggcctgccttacgcgctaatgtctacctagaagggtgcatgaca
gaaacctaccccgacctcactcaagatctttcaggaatagaaaaactgatgaaagacttt
tcccatccaggtggagttccaagtcatgtgagccctccaactccaggttcgattcatgaa
ggaggagaacttggctactccctcgtccatgcttacggagccatcttagacaatcccgag
ctgattgctgtttgcgtcgtgggagatggagaagctgaaacgggacctcttgcaacaagt
tggcaatcaaacaagtttatcaacccgaaacgagatggagctgtcttgccgattctacat
ctcaacgggtataaaatctcaggaccaactgtttttggaaggatgcccgacacgaaaatt
gagcaatttttcaaagggtgtggatatcagccccgtttcattgaaggagacgatcctaag
tctcttcaccctgtcctttggaaaacgctcgactgggcttatgctgaaattcgaaaaaaa
caatcggaacctttcgatggaaatcctgtcgaatggccgatgatcgtgatgcgcacccca
aaaggatggacgggccctaaagaagtcgatggaaaaaaaatagaaggcacctttcgctcg
catcaagttcccctctccgatgtcatcgaaaaaaaagaccatcttgaaatcctcgaaaat
tggatgaaaagttacaagccgcaggagctctttgatgcagcaggaaaacccaattcaaac
atcttatctattgttcctccaaaagaactccgcatgggctctacccctcatgcaaatgga
ggccttctcctcaaagaattaaccatcccagacacggcagattacgaagtgaaagtcccg
agcccaggaagtgtgatagccgaagccactcgcgtacttggaaaactcgtgcgggatatc
atgaaagaaaacaaagataactttcgggtcttttgtcctgatgaaaccaattccaaccga
ttcaatcacgtctttgaagtcacaggacgaacttatcttggagaaatttttgatagcgat
gacgacttatctcatgaaggacgtgtcatggaagtgctcagcgaacatctttgtcaagga
tggcttgaagggtatctcctcactggacggcatgggatctttccctgctacgaagccttt
gctctcattgtcgattcgatgctgaaccaacacggaaaatggctcaaagcttgccaagaa
cttccctggagaaagcccattgcctctctcaactatttgctcacttcccatgcatggcgt
caagatcacaatggatacagccatcaaggacctggatttatcgaatctgtcatgcaaaag
aaatgctccattgcccggatctatctccctcctgatgccaactgcttactcgaggtcgga
aaacactgtttaaagagtaaaaactacatcaacttgattatttctggaaaacagcccatg
cctcaatggctaaacatgaaacaagctaaagaacattgcactaaaggagcctctatctgg
gattgggcatccaatgacaatgggcatcccgacatcatcatggcagctgctggtgacatt
ccaactctcgaaacccttgctgctatttcaattctgcgaaaaaaatttcctgatctaaag
atccgcatggtcaatgttgtcgacctcttcacactgatgccccattcgcgtcatcctcac
ggatttgatgaggaaaccttcgcctctctttttggaacagagactcctgttatttttgcc
tttcatggccaccctcgggtcatccacgaactcacctacaagcgctcttatcctcaccga
ttccacgtccggggttacattgaagaaggaacgacaacaacacctttcgatatggttgtt
tgtaatgagatgagccgttttcatttagcagttgaagcgttgcatcacctgccacagatg
aaatccgttgctggagattttattacagaatgcacacagaagctagatgaccataaggtc
tatatttatgaacatggggaagatattcctgaagtccgtaattggaaatgggaggcataa

DBGET integrated database retrieval system