KEGG   Simkania negevensis: SNE_A13540Help
Entry
SNE_A13540        CDS       T01559                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sng  Simkania negevensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sng00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
gsn.131:1411848..1413332
Genome map
AA seq 494 aa AA seqDB search
MQYILALDQGTTSSRAIILTKEGHIVGIAQKELQQIFPNPGWVEHNACEIWSSQASVMTG
ALAMAHLKMRDIAAIGITNQRETTIVWDRKTSHPIHNAIVWQDRRTRTFCQSLKQEGYEP
LFQKKTGLLLDPYFSGTKLRWILDNVPNAREKAERGELAFGTVDSWLLWQLTDGRYHITD
ATNASRTLLYNIHTHEWDNELLEILKIPRSLLPEVRDSSEVYAECSSTVCSSSTPIAGIA
GDQQAALFGHSCFKKGMGKATYGTGCFILMNTGPKPAPVKNHLLTTIAYKIGNKTHYALE
GSVFIGGAVVQWLRDNLGIIKHSRDIETLAKQSMNSNGVTFVPAFTGLGAPYWDPNTRGT
IFGLTRGTQNSHIAYAALESIAFQVADVLDLMHELTPITQLRVDGGAVENNLLMQIQADY
SNIPLVRPKWKEMTALGACFLAGLAVGFWKDLDEIQKLWKKEHEFFPSINDVKRKEAKNK
WDKAVHWAKMWGNS
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatattttagcccttgaccaaggaacgactagttcacgagcaatcattttaaca
aaagaaggacatattgttgggattgcgcaaaaagagctgcaacaaattttccccaaccca
ggctgggtcgaacacaatgcatgtgaaatttggtcttcgcaagcatctgtcatgactggt
gctctagctatggcacacctaaaaatgcgagacatcgcagctatcggaatcacaaatcaa
agagaaactacgattgtatgggatagaaaaacttcccaccccattcacaatgcaatcgtg
tggcaagatagacggactcgcacattttgccaaagtctcaaacaagaaggatatgaacct
cttttccaaaaaaaaaccggtcttttgttagatccttacttttctgggacaaagcttcga
tggattttagataatgttcctaatgcgcgagaaaaagctgaaagaggagaacttgctttt
ggaactgtagattcctggttgttatggcagctcacagatgggcgctatcacatcacagac
gccacaaatgcttctcgaacgttactatacaacattcatacccatgaatgggataatgag
ctcttagaaatcttaaaaattccccgctctctcttgccagaagtgagagattcaagcgag
gtatacgctgaatgttcttctactgtttgttcctcatcaacgccaattgcaggaatagct
ggagaccaacaagctgctctctttggtcattcttgctttaaaaaaggaatgggcaaagcg
acatatggaacgggctgttttatcttaatgaacaccggcccaaagcctgctccagtaaaa
aaccaccttctgacaactattgcatacaaaatcggaaacaaaacacattacgccttagaa
ggaagcgtcttcataggaggagctgttgtgcaatggcttagagataatctcggtattatt
aaacattcgagagatatagagactttagctaaacaaagcatgaactcgaatggtgtgact
tttgttccagcctttactggacttggagctccctattgggaccccaacactagaggaaca
atctttggcctgactcgagggactcaaaattcacatattgcctatgcagcgcttgaaagc
attgcatttcaagttgcggatgttttagatctcatgcacgagttaacccctattacccaa
cttcgagttgacggaggggctgttgaaaataacttactcatgcaaattcaagctgattat
tcaaatattccactagttagacctaagtggaaagaaatgacagctctcggagcttgtttt
ttggcaggactcgccgttggattttggaaggatctagatgaaattcagaagctctggaaa
aaagagcatgagttctttccatcgatcaatgacgtcaaacgaaaagaagcaaaaaacaaa
tgggataaagctgtacattgggcaaaaatgtggggcaattcatga

DBGET integrated database retrieval system