KEGG   Simkania negevensis: SNE_A15040Help
Entry
SNE_A15040        CDS       T01559                                 

Definition
hypothetical protein
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
sng  Simkania negevensis
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:sng03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
gsn.131:1568763..1569608
Genome map
AA seq 281 aa AA seqDB search
MPEYYEVKRICCYLQEAGIEGSTIQSIELFPGSEILLKQFSLTKWEKLLKNEKILSIQTK
AKYTFLQLSHGAMVWHYRFTGIPHMEGQNYETKLYTIFNLPVDGSMQYCRFKLQLDGNKI
LSYLDTRCLSDIKFYPNAHIGKLEIYQKLAPDIGHFQPQPYSMWKMQLNKRKRDLKLELQ
DQFTTPSGIGNYLACEILAYAKLNPWISVSHITEAQYGQLCQAIAAVQELCKKNAHYNWF
RVFNQQKCAACNQLVLRQKHRLSRSSQTTHYCPNCQQETPK
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgccagaatattacgaagtcaaacgcatttgctgttacctgcaagaagcgggaattgaa
ggaagcactattcaaagtatagagctatttcccggttcggaaattctgctcaagcaattt
tccctcacgaaatgggaaaaactgctaaaaaacgaaaaaattctctcgattcaaaccaaa
gcaaaatacactttccttcaactcagtcatggagcaatggtttggcactaccgatttaca
ggaattcctcatatggaggggcaaaactatgagaccaaactctacacaatcttcaattta
ccagttgacggcagtatgcagtattgtcggttcaaacttcaactagatggaaacaaaata
ctttcctacctcgacacccgatgcctatccgatatcaaattctaccccaatgctcatatc
ggtaaactggagatttaccaaaaacttgcccctgatatcggtcacttccaaccacaacct
tattcgatgtggaaaatgcaactaaacaagcgcaaacgtgatttgaagctcgagcttcaa
gatcaattcacaacgccgtctggaatcggtaattaccttgcctgcgaaattttagcctat
gccaaactaaatccctggatttctgtttctcacataacagaagcccaatacggccagctc
tgtcaggcaattgctgcggtgcaggagctttgtaaaaaaaatgcacactacaattggttt
cgcgtatttaaccagcaaaagtgcgccgcctgtaatcagctagttctcaggcaaaagcat
cgtttaagtcgttctagtcaaacaactcactactgtcccaactgccaacaggagacccct
aaatga

DBGET integrated database retrieval system