KEGG   Simkania negevensis: SNE_A15430Help
Entry
SNE_A15430        CDS       T01559                                 

Definition
phosphoglycerate mutase family protein
Orthology
K15634  
probable phosphoglycerate mutase [EC:5.4.2.12]
Organism
sng  Simkania negevensis
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sng00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SNE_A15430
   01230 Biosynthesis of amino acids
    SNE_A15430
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SNE_A15430
  Energy metabolism
   00680 Methane metabolism
    SNE_A15430
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SNE_A15430
Enzymes [BR:sng01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.12  phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
     SNE_A15430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
gsn.131:complement(1610062..1610682)
Genome map
AA seq 206 aa AA seqDB search
MTTLIIVRHGNTFEKGETPRRVGGRTDIPLVSSGVYQAQCIGRYLQKMNISLDAVYSSPL
LRTRKSADIILEVLGSNTSVIPLEIFKEIDYGPDENQTEEKVISRIGVRAIEAWNQHAKV
PEGWNAHPDAIISNWKVFAKEMREKYPTGTILVTTSNGILRFSPHITGIFAAFAQKYPIK
VSTGALCIFKYLHDRWTITEWNLKPS
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgacaacactcattatcgttcgccatggaaatacctttgaaaaaggcgaaactcctcgc
cgcgttggagggagaacagacattcctcttgtttcttcaggtgtctatcaggctcaatgt
attggtcgatatctgcaaaaaatgaatatttccctagatgctgtttactcttctcctctc
ttgcgcacccgaaaaagtgcggatatcatactagaagttcttggatccaacacttccgtt
attcctttagagatttttaaagaaattgattatggtccagacgaaaaccagaccgaagaa
aaagtgataagtcggattggtgttcgagctatagaagcatggaaccagcacgccaaagta
cctgaagggtggaatgctcatccagatgcaattatcagtaattggaaagtttttgctaaa
gaaatgcgcgaaaagtacccaacaggaacaatccttgtgacaacaagtaatgggatctta
cgcttttctccccacataacaggaatttttgctgcttttgcgcaaaaatatcctatcaaa
gtgagtacaggtgcactttgtatctttaagtatcttcacgatcgttggacaatcactgag
tggaacttaaaaccgtcatag

DBGET integrated database retrieval system