KEGG   Simkania negevensis: SNE_A17690Help
Entry
SNE_A17690        CDS       T01559                                 

Gene name
malQ-A
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sng  Simkania negevensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sng00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SNE_A17690 (malQ-A)
Enzymes [BR:sng01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     SNE_A17690 (malQ-A)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
gsn.131:1843061..1844635
Genome map
AA seq 524 aa AA seqDB search
MSLESKLQGKITYNAWKRIGIHAHHGINIPLFSIHTKKSCGVGEFYDLLPLIDWCAKHGM
DVIQLLPLNDSGQDPSPYNALSSCALHPIYLSLHALPYSDGMEVKLEPLRALNSSKHLQY
EHIYQEKLRFLRKYIKRAKEDLLKEGDYEEFVTKHHWLNPYALFRVLKNKCDHTHWKHWP
KELQSPSTHQLKKLYSEHSNEIEIYSIIQYLCFKQLKKVKSYAESKGVFLKGDVPILVSP
DSADVWMDPTFFDFNYVAGSPPNQFNPEGQYWGFPLYNWPAMKQDHYEWWKKRLLTAAEL
YHLYRIDHIIGFFRLWAIPPDQDPAQGTFVPSDPAIMEAQGDRILQILAGFTDMLPIGED
LGHPPSFLQMSLNKYGIPGTKVFRWQRDWANGETFIPYESYEPISMTSVSTHDLSTVRLW
WKKHPKESKAYAAFKGWKYKKELSPEYQLEILYDNHHSSSLFHINLLQEYLALVPELTWE
NPDDERINYPGTLKPHNWKYRYKFPLETLTTHNAFNEGIKRVLS
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgagtcttgagtctaagctgcaaggaaaaatcacctataatgcttggaaacggataggg
attcatgctcaccatggaatcaatattcccctctttagtatccacactaaaaaaagctgt
ggtgtaggagagttttatgatcttctccccctcatcgactggtgtgcaaaacatggcatg
gatgtcatccaacttttacccctcaacgactcaggtcaagaccctagtccttacaatgcc
ctttcttcgtgtgctctccatcctatttacctcagtttgcatgccctcccctactctgat
ggaatggaagtaaaacttgagcccctacgggctctaaatagctctaaacacctgcaatat
gagcatatttatcaggaaaaactgcgcttcttacgcaaatacattaaacgggcaaaagag
gatctcctcaaagagggcgactatgaagagtttgtcactaaacatcattggctcaatcct
tatgcactctttcgagttttaaaaaacaaatgcgatcacactcactggaagcattggcca
aaagaactccaaagtccttctacccatcaattgaaaaaactctactctgagcactccaat
gaaatcgaaatctactcgatcattcaatacctttgctttaagcagctcaaaaaggtgaag
tcttatgctgaatcaaaaggggtctttttaaaaggagatgttcccattcttgtcagtcct
gacagtgccgatgtctggatggaccccacattttttgatttcaactacgttgcgggaagt
ccccctaatcagtttaatcctgaaggacaatattggggctttcctctttataactggcct
gcaatgaagcaagatcactacgaatggtggaaaaaacggcttctcaccgctgcagaactt
tatcacttgtatcggatcgatcacattattggtttttttcgcttatgggcaattccccct
gatcaagatcctgctcaagggaccttcgtcccaagtgatccagccatcatggaagctcaa
ggagatcgaattcttcaaattctcgccggttttactgatatgctcccgatcggtgaagac
ttaggacaccccccttcttttttacagatgagtctcaacaaatacggaattcccggcaca
aaagtttttcgttggcaacgagactgggctaatggagaaacattcattccttacgaaagt
tacgaacccattagcatgacctctgtttctactcacgatcttagcactgtcagactctgg
tggaagaaacatcctaaagaatccaaagcctacgctgccttcaaaggatggaaatataaa
aaagaactttctccagagtatcaactcgaaatcctgtatgacaaccaccatagtagtagc
ttgtttcacatcaatctcttgcaagagtatcttgctcttgtccctgagctcacctgggaa
aatccagatgatgaacggatcaattacccaggaacgctcaaaccccataactggaagtac
cgatataagtttccactagaaacgcttacaacgcacaatgccttcaatgaaggcataaaa
agagtcctttcttga

DBGET integrated database retrieval system