KEGG   Simkania negevensis: SNE_A17880Help
Entry
SNE_A17880        CDS       T01559                                 

Gene name
malQ-B
Definition
(GenBank) 4-alpha-glucanotransferase
  KO
K00705  4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sng  Simkania negevensis
Pathway
sng00500  Starch and sucrose metabolism
sng01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sng00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SNE_A17880 (malQ-B)
Enzymes [BR:sng01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     SNE_A17880 (malQ-B)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_77
Motif
Other DBs
NCBI-ProteinID: CCB89665
UniProt: F8L9V9
Position
gsn.131:complement(1868692..1870287)
Genome map
AA seq 531 aa AA seqDB search
MENLKSQLLNSPARYLWERIGIFSHHGIDLPVSALRTKKSCGIGEFFDLLPIIDWCHEIK
LDVLMLLPLNECTTDPSPYNSISSRALHPIYLSLEELPYLQSYPKVKGKLAAFRYLNETP
RIQYHEVLQKKMVWLREYFEAVKESFLANPDFENFKESHHWLKPYALFKVLKHKMEQAPW
TTWPKELLSPSKGEYDQLIEDNQDDIIFHIALQFLCYEQMKCVKNYSLAKQVFLKGDIPI
LINPDSVDVWAEPHLFDLTKAAGAPPDAYSSEGQYWGCPLFNWNAMRKYAENYEWWKERL
DFAGHFYDLFRIDHIVGFFRIWGIPHNHSPKAGSYIPADPSEWIPQGQEILQFLHHNSNM
LPIGEDLGTVPREIKHCLAKLGIPGTKIIRWERKEDKKRSFIPYDEYPRLSMTSVSTHDT
EPLALWWQVQKDEAKAFAEFKGWSYSPTLSFDQHREILRDSHQTPSLFHINLLQDYLSLF
PELVWENLKDEQINIPGTTSPFNWTYRFRPSVEEIVSHEGLKKTMKELIRD
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatcttaaatcacaacttttgaattctccagcaaggtatctttgggagagaatt
gggatcttttcccatcatgggatcgatctgcctgtatctgcattgcggacgaaaaaaagc
tgtggcattggggagtttttcgatttgctaccgattattgattggtgtcatgagatcaag
ctcgatgtgttaatgcttcttccactcaatgaatgcacaactgaccctagtccatataat
agcatctcttcacgggcactccatccaatttatctctcgttggaagagcttccttatctc
caaagctatcccaaagtgaaagggaaactggcagcgtttcgctatttgaatgagactcct
cgcattcagtaccatgaagttctccaaaagaagatggtgtggttacgtgagtattttgag
gcggtgaaggaaagctttttggcaaatccagactttgaaaattttaaagaaagccatcat
tggcttaagccttatgcactttttaaggtgcttaaacacaaaatggagcaggctccctgg
acaacttggccaaaagagctattgtcaccgtcgaaaggggaatatgatcagctgatcgag
gataatcaagatgacatcatttttcatattgctctccaattcttatgttacgagcagatg
aagtgtgtcaaaaattattctttggccaaacaggtgtttttaaaaggagacattcccatt
ctcatcaatcctgatagtgtcgatgtttgggctgaacctcatttatttgacttgacgaag
gccgcgggtgctccgcccgatgcttatagctcagaaggacagtattggggctgcccactc
tttaattggaatgcgatgagaaagtatgcggaaaattatgagtggtggaaagagcggctt
gattttgccggacatttttacgatttgtttcgtattgatcatatcgtgggcttttttcgt
atttggggaattccccataatcattcgccaaaggctggaagctatattccggcagatccc
tcagaatggattccgcaagggcaagagattctccaatttcttcaccataattcgaacatg
ttgccaataggagaagatcttggaacagttcctagagaaatcaagcattgtcttgcaaag
ttaggaattcctgggacaaaaattattcgttgggaacgcaaagaagataagaagagatcg
tttattccctatgatgagtatcctcggctcagtatgacgtctgtttctactcatgataca
gaaccgttagccctttggtggcaagtccaaaaggatgaagccaaagcatttgctgaattc
aaggggtggtcctattcaccaacactcagctttgatcagcatcgagaaattttacgcgat
agtcatcagactcccagcttgtttcatattaaccttcttcaagattatctcagcttgttt
cccgaactcgtttgggaaaacctcaaagacgagcaaatcaatatccctggaacgacgtct
ccattcaattggacctaccggttccgtccttctgttgaagaaattgtcagccatgaggga
cttaagaaaacaatgaaagaactcattcgagattga

DBGET integrated database retrieval system