KEGG   Simkania negevensis: SNE_A18390Help
Entry
SNE_A18390        CDS       T01559                                 

Definition
protein disulfide isomerase
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
sng  Simkania negevensis
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
gsn.131:complement(1917617..1918579)
Genome map
AA seq 320 aa AA seqDB search
MKKWICLLTLCGSLLYGQEASLFITEDYQKAERVARENGITLAVVFTGSDWSTDSKAFLS
EWLFHKDRGKALRHDLVFAWVDFPELNTKDAHLVEQDFRLKEQLHITCFPTIVLLDPSGE
EITRLGYPTEEDFAVLVKERLFIYEHLADKWALAKETQSEQLITTCYNEAQTLGLAPLLE
EIVAFASDKRVCPELLFKRYVTLVNEGNRNHPDAKQLRHYLLKSDPHNEKGIREKIALFD
FQEQRNAFPLETVLKQFCSHESENFWRIHLVLSEHFFENGKSEEALEHAQESYRYAPPLG
KEVVSHLIKRISMTSHGESP
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagtggatctgtcttttaactttatgcggaagcctcctctatgggcaggaagct
tccttgttcatcaccgaagattatcaaaaagctgagcgagtcgcacgagaaaatggtatt
accttagctgttgtttttaccggctctgactggtcaactgatagcaaggcctttttgagc
gagtggcttttccacaaagaccgaggaaaagccttgcgtcacgatctcgtctttgcttgg
gttgattttcctgaactcaacactaaagacgcccatttagttgagcaagatttccgtcta
aaagagcagttgcacattacatgctttccaacgattgtcttacttgatccttcgggagaa
gaaatcacccgtttggggtatccaactgaagaggattttgcggtccttgtcaaagagagg
ctcttcatttatgagcaccttgctgataaatgggcgctggcaaaggagactcaaagtgag
caattgatcactacatgttataatgaagctcaaacacttggattagcaccacttttagaa
gaaatcgttgcatttgcatcagataaaagagtttgtccagagcttttatttaagcggtat
gtgactttagttaatgaagggaatcggaatcatcctgatgctaagcaattgcgtcactac
ttgctcaaatcagatccacataatgaaaaagggatacgtgaaaaaattgccctttttgac
tttcaggagcagagaaacgctttcccattagaaacagttctcaaacaattttgctctcac
gaatcggaaaacttttggcggatccatttggtgctttcagaacatttttttgaaaatgga
aaatcagaagaagcgcttgaacatgcccaagaatcataccggtatgcaccacctttaggt
aaagaggtagtatcgcatcttattaagcgaatttccatgacgtcacacggagaatctcct
tag

DBGET integrated database retrieval system