KEGG   Simkania negevensis: SNE_A18390Help
Entry
SNE_A18390        CDS       T01559                                 

Definition
(GenBank) protein disulfide isomerase
  KO
K01829  protein disulfide-isomerase [EC:5.3.4.1]
Organism
sng  Simkania negevensis
Brite
Enzymes [BR:sng01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     SNE_A18390
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin_7 Sec7 Thioredoxin_2 TPR_2 Thioredoxin_8
Motif
Other DBs
NCBI-ProteinID: CCB89716
UniProt: F8L378
Position
gsn.131:complement(1917617..1918579)
Genome map
AA seq 320 aa AA seqDB search
MKKWICLLTLCGSLLYGQEASLFITEDYQKAERVARENGITLAVVFTGSDWSTDSKAFLS
EWLFHKDRGKALRHDLVFAWVDFPELNTKDAHLVEQDFRLKEQLHITCFPTIVLLDPSGE
EITRLGYPTEEDFAVLVKERLFIYEHLADKWALAKETQSEQLITTCYNEAQTLGLAPLLE
EIVAFASDKRVCPELLFKRYVTLVNEGNRNHPDAKQLRHYLLKSDPHNEKGIREKIALFD
FQEQRNAFPLETVLKQFCSHESENFWRIHLVLSEHFFENGKSEEALEHAQESYRYAPPLG
KEVVSHLIKRISMTSHGESP
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagtggatctgtcttttaactttatgcggaagcctcctctatgggcaggaagct
tccttgttcatcaccgaagattatcaaaaagctgagcgagtcgcacgagaaaatggtatt
accttagctgttgtttttaccggctctgactggtcaactgatagcaaggcctttttgagc
gagtggcttttccacaaagaccgaggaaaagccttgcgtcacgatctcgtctttgcttgg
gttgattttcctgaactcaacactaaagacgcccatttagttgagcaagatttccgtcta
aaagagcagttgcacattacatgctttccaacgattgtcttacttgatccttcgggagaa
gaaatcacccgtttggggtatccaactgaagaggattttgcggtccttgtcaaagagagg
ctcttcatttatgagcaccttgctgataaatgggcgctggcaaaggagactcaaagtgag
caattgatcactacatgttataatgaagctcaaacacttggattagcaccacttttagaa
gaaatcgttgcatttgcatcagataaaagagtttgtccagagcttttatttaagcggtat
gtgactttagttaatgaagggaatcggaatcatcctgatgctaagcaattgcgtcactac
ttgctcaaatcagatccacataatgaaaaagggatacgtgaaaaaattgccctttttgac
tttcaggagcagagaaacgctttcccattagaaacagttctcaaacaattttgctctcac
gaatcggaaaacttttggcggatccatttggtgctttcagaacatttttttgaaaatgga
aaatcagaagaagcgcttgaacatgcccaagaatcataccggtatgcaccacctttaggt
aaagaggtagtatcgcatcttattaagcgaatttccatgacgtcacacggagaatctcct
tag

DBGET integrated database retrieval system