KEGG   Simkania negevensis: SNE_A22350Help
Entry
SNE_A22350        CDS       T01559                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sng  Simkania negevensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sng00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SNE_A22350
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SNE_A22350
   00052 Galactose metabolism
    SNE_A22350
   00500 Starch and sucrose metabolism
    SNE_A22350
   00520 Amino sugar and nucleotide sugar metabolism
    SNE_A22350
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SNE_A22350
   00524 Butirosin and neomycin biosynthesis
    SNE_A22350
Enzymes [BR:sng01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SNE_A22350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
gsn.131:complement(2321729..2322703)
Genome map
AA seq 324 aa AA seqDB search
MHLVGVDIGGTKVSVCLGDGEGNIIDHKRVMTATLGDPTTGLPKIVELIGHLLRDNNLEI
HEIKAIGLAVPGPISYKMGMMLTPPNMPTWVNVPVREYFREAFEKPVFLNNDANAGVLAE
WEFGAAKHLDNLVYLTMSTGMGGGIIAQGKLLQGETDTAGEVGHFVLDPKGPKCPCGQRG
CFEVFCGGANLARRTQEEIKQKKIQTAILDAAEGEVEKIDMKCIAAAVKNDDLYALEIWE
GFIERLAQGIGILLMTLNPDAIILGTIASHTHELVMSPLKRALAKYAWMMPLEYCRIEES
KLSDRISKLAPLALAIEGLRNVET
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcatttagtaggtgtcgatattggcgggaccaaggtgtcagtttgtttgggggatggg
gaagggaatatcattgaccacaagcgggtgatgacagctacgctcggagaccccacaaca
ggtcttcctaaaattgtcgagcttatcggccatcttttaagagacaataaccttgagatt
cacgaaatcaaagccatcggcttggctgtgccaggacctatttcatacaaaatgggaatg
atgctcactccccccaatatgccaacttgggtgaatgttcctgttcgtgaatactttaga
gaagctttcgagaagccggtctttctcaataatgatgcaaatgcaggagttcttgcagaa
tgggagtttggagcggcaaaacatctagacaacttggtttatctgaccatgagtactggg
atgggaggaggaattattgcgcagggaaaactgcttcagggtgaaaccgacacagcaggt
gaggtcgggcattttgttttagatcccaaagggcctaagtgtccatgtggacaacgggga
tgttttgaagtgttttgtgggggagcaaatcttgctcgtcggacccaagaagaaatcaag
caaaagaagattcaaacggcaatcttggatgctgcggaaggggaagttgaaaaaatagac
atgaagtgcattgcagcagcagtcaaaaatgatgatctctatgctctagagatctgggaa
gggttcatcgagcgtcttgcccaagggattggaattttactcatgacactcaaccccgat
gcgatcatactaggaacgattgcatcacatacgcatgaactagtcatgtcgccactcaaa
cgggcgcttgcaaagtatgcgtggatgatgccccttgagtattgccgtattgaagagagc
aagctcagtgatcgaattagtaaattagctcctctagctcttgcaatcgaagggctaagg
aatgtagaaacgtaa

DBGET integrated database retrieval system