KEGG   Simkania negevensis: SNE_A22350Help
Entry
SNE_A22350        CDS       T01559                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sng  Simkania negevensis
Pathway
sng00010  Glycolysis / Gluconeogenesis
sng00052  Galactose metabolism
sng00500  Starch and sucrose metabolism
sng00520  Amino sugar and nucleotide sugar metabolism
sng00521  Streptomycin biosynthesis
sng01100  Metabolic pathways
sng01110  Biosynthesis of secondary metabolites
sng01120  Microbial metabolism in diverse environments
sng01130  Biosynthesis of antibiotics
sng01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sng00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SNE_A22350
   00052 Galactose metabolism
    SNE_A22350
   00500 Starch and sucrose metabolism
    SNE_A22350
   00520 Amino sugar and nucleotide sugar metabolism
    SNE_A22350
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SNE_A22350
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SNE_A22350
Enzymes [BR:sng01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SNE_A22350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: CCB90112
UniProt: F8L471
Position
gsn.131:complement(2321729..2322703)
Genome map
AA seq 324 aa AA seqDB search
MHLVGVDIGGTKVSVCLGDGEGNIIDHKRVMTATLGDPTTGLPKIVELIGHLLRDNNLEI
HEIKAIGLAVPGPISYKMGMMLTPPNMPTWVNVPVREYFREAFEKPVFLNNDANAGVLAE
WEFGAAKHLDNLVYLTMSTGMGGGIIAQGKLLQGETDTAGEVGHFVLDPKGPKCPCGQRG
CFEVFCGGANLARRTQEEIKQKKIQTAILDAAEGEVEKIDMKCIAAAVKNDDLYALEIWE
GFIERLAQGIGILLMTLNPDAIILGTIASHTHELVMSPLKRALAKYAWMMPLEYCRIEES
KLSDRISKLAPLALAIEGLRNVET
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcatttagtaggtgtcgatattggcgggaccaaggtgtcagtttgtttgggggatggg
gaagggaatatcattgaccacaagcgggtgatgacagctacgctcggagaccccacaaca
ggtcttcctaaaattgtcgagcttatcggccatcttttaagagacaataaccttgagatt
cacgaaatcaaagccatcggcttggctgtgccaggacctatttcatacaaaatgggaatg
atgctcactccccccaatatgccaacttgggtgaatgttcctgttcgtgaatactttaga
gaagctttcgagaagccggtctttctcaataatgatgcaaatgcaggagttcttgcagaa
tgggagtttggagcggcaaaacatctagacaacttggtttatctgaccatgagtactggg
atgggaggaggaattattgcgcagggaaaactgcttcagggtgaaaccgacacagcaggt
gaggtcgggcattttgttttagatcccaaagggcctaagtgtccatgtggacaacgggga
tgttttgaagtgttttgtgggggagcaaatcttgctcgtcggacccaagaagaaatcaag
caaaagaagattcaaacggcaatcttggatgctgcggaaggggaagttgaaaaaatagac
atgaagtgcattgcagcagcagtcaaaaatgatgatctctatgctctagagatctgggaa
gggttcatcgagcgtcttgcccaagggattggaattttactcatgacactcaaccccgat
gcgatcatactaggaacgattgcatcacatacgcatgaactagtcatgtcgccactcaaa
cgggcgcttgcaaagtatgcgtggatgatgccccttgagtattgccgtattgaagagagc
aagctcagtgatcgaattagtaaattagctcctctagctcttgcaatcgaagggctaagg
aatgtagaaacgtaa

DBGET integrated database retrieval system