KEGG   Streptococcus pneumoniae INV104: INV104_00480Help
Entry
INV104_00480      CDS       T02072                                 

Gene name
strH
Definition
beta-N-acetylhexosaminidase precursor (ec 3.2.1.52) (sortase-sorted) (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
sni  Streptococcus pneumoniae INV104
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sni00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    INV104_00480 (strH)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    INV104_00480 (strH)
Enzymes [BR:sni01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     INV104_00480 (strH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(59612..63550)
Genome map
AA seq 1312 aa AA seqDB search
MKHEKQQRFSIRKYAVGAASVLIGFAFQAQTVAADGVTPTTTENQPTIHTVSDSPQSSEN
RTEETPKAELQPEAPKTVETETPATDKVASLPKTEEKPQEEVSSTPSDKAEVVTPTSAEK
ETANKKAEEASPKKEEAKEVDSKESNTDKTDKDKPAKKDEAKAEDDKPETEAGKERAATV
NEKLAKKKIVSIDAGRKYFSPEQLKEIIDKAKHYGYTDLHLLVGNDGLRFMLDDMSITAN
GKTYASDDVKRAIEKGTNDYYNDPNGNHLTESQMTDLINYAKDKGIGLIPTVNSPGHMDA
ILNAMKELGIQNPNFSYFGKESARTVNLDNEQAVAFTKALIDKYAAYFAKKTEIFNIGLD
EYANDATDAKGWSVLQADKYYPNEGYPVKGYEKFIAYANDLARIVKSHGLKPMAFNDGIY
YNSDTSFGSFDKDIIVSMWTGGWGGYDVASSKLLAEKGHQILNTNDAWYYVLGRNADGQG
WYNLDQGLNGIKNTPITSVPKTEGADIPIIGSMVAAWADTPSARYSPSRLFKLMRHFANA
NAEYFAADYESAEQTLNEVPKDLNRYTAESVAAVKEAEKAIRSLDSNLSRAQQDTIDQAI
AKLQETVNNLTLTPEAQKEEEAKREVEKLAKNKVISIDAGRKYFTLNQLKRIVDKASELG
YSDVHLLLGNDGLRFLLDDMTITANGKTYASDDVKKAIIEGTKAYYDDPNGTALTQAEVT
ELIEYAKSKDIGLIPAINSPGHMDAMLVAMEKLGIKNPQAHFDKVSKTTMDLKNEEAMNF
VKALIGKYMDFFAGKTKIFNFGTDEYANDATSAQGWYYLKWYQLYGKFAEYANTLAAMAK
ERGLQPMAFNDGFYYEDKDDVQFDKDVLISYWSKGWWGYNLASPQYLASKGYKFLNTNGD
WYYILGQKPEDGGGFLKKAIENTGKTPFNQLASTKYPEVDLPTVGSMLSIWADRPSAEYK
EEEIFELMTAFADHNKDYFRANYNALREELAKIPTNLEGYSKESLEALDAAKTALNYNLN
RNKQAELDTLVANLKAALQGLKPAATHSGSLDENEVAANVETRPELITRTEEIPFEVIKK
ENPNLPAGQENIITAGVKGERTHYISVLTENGKTTETVLDSQVTKEVINQVVEVGAPVTH
KGDESGLAPTTEVKPRLDIQKEEIPFTTVTRENPLLLKGKTQVITKGVNGHRSNFYSVST
SADGKEVKTLVNSVVAQEAVTQIVEVGTMVTHVGDENGQAAIAEEKPKLEIPSQPAPSTA
PAEESKALPQDPAPVVIEKKLPETGTHDSAGLVVAGLMATLAAYGLTKRKED
NT seq 3939 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatgaaaaacaacagcgtttttctattcgtaaatacgctgtaggagcagcttct
gttctaattggatttgccttccaagcacagactgttgcagccgatggagttactcctact
actacagaaaaccaaccgaccatccatacggtttctgattcccctcaatcatccgaaaat
cggactgaggaaacacctaaagcagagcttcaaccagaagctccaaaaactgtagaaaca
gaaactccagctactgataaggtagctagtcttccaaaaacagaagaaaaaccacaagag
gaagttagttcaactcctagtgataaagcagaagtggtaactccaacttctgctgaaaaa
gaaactgctaataaaaaggcagaagaagctagccctaaaaaggaagaagcgaaagaggtt
gattctaaagagtcaaatacagacaagactgacaaggataaaccagctaaaaaagatgaa
gcgaaagcagaggatgacaaaccggaaacagaggcaggaaaggaacgtgctgcaactgta
aatgaaaaactagcgaaaaagaaaattgtttctattgatgctggacgtaaatatttctca
ccagaacagctcaaggaaatcatcgataaagcgaaacattatggctacactgatttacac
ctattagtcggaaatgatggactccgtttcatgttggacgatatgagcatcacagctaac
ggcaagacctatgccagtgacgatgtcaaacgcgccattgaaaaaggtacaaatgattat
tacaacgatccaaacggcaatcacttaacagaaagtcaaatgacagatctgattaactat
gccaaagataaaggtatcggtctcattccgacagtaaatagtcctggtcacatggatgcg
attctcaatgccatgaaagaattgggaatccaaaaccctaactttagctattttgggaag
gaatcagcccgtactgtcaatcttgacaacgaacaagctgtcgcttttacaaaagccctt
atcgacaagtatgctgcttatttcgcgaaaaagactgaaatcttcaacatcggacttgat
gaatatgccaatgatgcgacagatgctaaaggttggagtgtgcttcaagctgataaatac
tatccaaacgaaggctaccctgtaaaaggctatgaaaaatttattgcctacgccaatgac
ctcgctcgtattgtaaaatcgcacggtctcaaaccaatggcctttaacgacggtatctac
tacaatagcgacacaagctttggtagttttgacaaagacatcatcgtttctatgtggact
ggtggttggggaggctacgatgtcgcttcttctaaactactagctgaaaaaggtcaccaa
atccttaataccaatgatgcttggtactacgttcttggacgaaacgctgatggccaaggc
tggtacaatctcgatcaggggctcaatggtattaaaaacacaccaatcacttctgtacca
aaaacagaaggagctgatatcccaatcatcggtagtatggtagctgcttgggctgacact
ccatctgcacgttattcaccatcacgcctcttcaaactcatgcgtcattttgcaaatgcc
aacgctgaatacttcgcagctgattatgaatctgcagagcaaacacttaacgaggtacca
aaagacctgaaccgttatactgcagaaagcgtcgcggccgtaaaagaagctgaaaaagct
attcgctctctcgatagcaaccttagccgtgcccaacaagatacgattgatcaagccatt
gctaaacttcaagaaactgtcaacaacttgaccctcacgcctgaagctcaaaaagaagaa
gaagctaaacgtgaggttgaaaaacttgccaaaaacaaggtaatctcaatcgatgctgga
cgcaaatactttactctgaaccagctcaaacgcatcgtagacaaggccagtgagctcgga
tattctgatgtccatctccttctaggaaatgacggacttcgctttctactcgatgatatg
accattactgccaacggaaaaacctatgctagtgatgacgttaaaaaagctattatcgaa
ggaactaaagcttactacgacgatccaaacggtactgcactaacacaggcagaagtaaca
gagctaattgaatacgctaaatctaaggacatcggtctcatcccagctattaacagtcca
ggtcacatggatgctatgctggttgccatggaaaaattaggtattaaaaatcctcaagcc
cactttgataaagtttcaaaaacaactatggacttgaaaaacgaagaagcgatgaacttt
gtaaaagccctcatcggtaaatacatggacttctttgcaggtaaaacaaagattttcaac
tttggtactgacgaatacgccaacgatgcgactagtgcccaaggctggtactacctcaag
tggtatcaactctatggcaaatttgccgaatatgccaacaccctcgcagctatggccaaa
gaaagagggcttcaaccaatggccttcaacgatggcttctactatgaagacaaggacgat
gttcagtttgacaaagatgtcttgatttcttactggtctaaaggctggtggggatataac
ctcgcatcacctcaatacctagcaagcaaaggctataaattcttgaataccaacggtgac
tggtactacattcttggtcaaaaaccagaagatggtggtggtttcctcaagaaagctatt
gagaatactggaaaaacaccattcaatcaactagcttctaccaaatatcctgaagtagat
cttccaacagtcggaagtatgctttcaatctgggcagatagaccaagcgctgaatacaag
gaagaggaaatctttgaactcatgactgcctttgcagaccacaacaaagactacttccgt
gctaattataatgctctccgcgaagaattagctaaaattcctacaaacttagaaggatat
agtaaagaaagtcttgaggcccttgacgcagctaaaacagctctaaattacaacctcaac
cgtaataaacaagctgagcttgacacacttgtagccaacctaaaagccgctcttcaaggc
ctcaaaccagctgcaactcattcaggaagcctggatgaaaatgaagtggctgccaatgtt
gaaaccagaccagaactcatcacaagaactgaagaaattccatttgaagttatcaagaaa
gaaaatcctaacctcccagctggtcaggaaaatattatcacagcaggagtcaaaggtgag
cgaactcattacatctctgtactcactgaaaatggaaaaacaacagaaacagtccttgat
agccaggtaaccaaagaagttataaaccaagtggttgaagttggcgctcctgtaactcac
aagggtgatgaaagtggtcttgcaccaactactgaggtaaaacctagactggatatccaa
aaagaagaaattccatttaccacagtgactcgtgaaaatccactcttactcaaaggaaaa
acacaagtcattactaagggcgtcaatggacatcgtagcaacttctactctgtgagcact
tctgccgatggtaaggaagtgaaaacacttgtaaatagtgtcgtagcacaggaagccgtt
actcaaatagtcgaagtcggaactatggtaacacatgtaggcgatgaaaacggacaagcc
gctattgctgaagaaaaaccaaaactagaaatcccaagccaaccagctccatcaactgct
cctgctgaggaaagcaaagctcttcctcaagatccagctcctgtggtaatagagaaaaaa
cttcctgaaacaggaactcacgattctgcaggactagtagtcgcaggactcatggccaca
ctagcagcctatggactcactaaaagaaaagaagactaa

DBGET integrated database retrieval system